KEGG   Alteromonas mediterranea U8: I634_16560Help
Entry
I634_16560        CDS       T02722                                 

Definition
(GenBank) malonic semialdehyde reductase
  KO
K09019  3-hydroxypropanoate dehydrogenase [EC:1.1.1.-]
Organism
amao  Alteromonas mediterranea U8
Pathway
amao00240  Pyrimidine metabolism
amao01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:amao00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    I634_16560
Enzymes [BR:amao01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     I634_16560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Nitroreductase
Motif
Other DBs
NCBI-ProteinID: AGP94996
Position
complement(3783533..3784153)
Genome map
AA seq 206 aa AA seqDB search
MTVSETTEIGTKDPISESGLAQLFSGAHTHTTWLDKKIDEAVLKQLYDLVKVGSTSANCS
PARFVFITSDEGREKLKPCLSSGNVEQTMTAPCTVIVAYDEEFYEELPTLFPYADAKSWF
TSSPEAAYETAMRNSSMQGAYLISAVRALGLDAGAMSGFNPKLLNETFFSDSTWKVNFLL
NIGYGDGKKVHKRLPRLSFEQACQIL
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgacggtatcagagacaactgaaattggaacaaaagaccctattagcgaaagtggtcta
gcccagctatttagcggtgcacacacccacaccacctggctagataaaaagatagatgag
gccgtgctaaagcagctttatgacttagtgaaagtaggctcgacatcggcaaactgcagc
ccggcgcgctttgtttttattacgtcagatgaagggcgggagaaactcaaaccttgtctt
tcaagcggtaatgttgagcaaaccatgacagccccttgtacggtcattgtggcttatgat
gaagaattctatgaagaattacctacgctatttccttacgcagacgctaagagctggttt
acctcaagcccagaggcggcttatgaaacggcgatgcgaaacagctcaatgcagggcgcg
tatttaattagcgctgtccgcgcactagggctcgatgccggtgccatgtctggctttaac
cccaaattactcaatgagactttcttttcagatagcacgtggaaggtgaacttcttactg
aacatcggctatggcgacggcaagaaagtccataaacgtttgcctcgcttaagcttcgaa
caagcttgtcaaatactgtaa

DBGET integrated database retrieval system