KEGG   Alteromonas mediterranea U8: I634_16580Help
Entry
I634_16580        CDS       T02722                                 

Definition
(GenBank) pyrimidine utilization protein A
  KO
K09018  pyrimidine oxygenase [EC:1.14.99.46]
Organism
amao  Alteromonas mediterranea U8
Pathway
amao00240  Pyrimidine metabolism
amao01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:amao00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    I634_16580
Enzymes [BR:amao01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.46  pyrimidine oxygenase
     I634_16580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Bac_luciferase
Motif
Other DBs
NCBI-ProteinID: AGP95000
Position
complement(3786390..3787478)
Genome map
AA seq 362 aa AA seqDB search
MDIGVFIPIGNNGWLISKNSPQFKPTFDLNKEIVMKAEKYDMDFALSMIKLRGFGGETEF
WDYNLESFTLMAGLAAVTSKIQLYATAATLVLPPAIMARMATTIDSISNGRFGVNLVTGW
QRPEYSQMGMWPGDEFFGNRYEYLDEYITVVKELWETGKSDFKGEHFQMDDCRMLPKPQR
KIPLICAGQSAAGMDFSARHADYNFCFGKGVNTPTAFAPTAARLTEAAEKHGRSVGSAVL
VMVIADETDEKAMAKWESYKDGKDQSALDWMATQGAADKKSGKDTNIRDMTNPTSAVNLN
MGTLVGSYASVASMLDEIATVPGCEGVLLTFDDFLKGMDDFGTKIQPLMKSRQHLLNTSG
AA
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atggatattggtgtatttattccgattggtaacaacggctggttaatttctaaaaattca
cctcagttcaaaccaacgttcgatctcaacaaagagattgtgatgaaggctgaaaagtac
gatatggatttcgcactctcgatgatcaagttacgaggatttggcggtgaaacggagttt
tgggattacaacttagaatcgttcaccctaatggccggtcttgctgccgttacttcaaaa
attcagctatatgccacagccgccacgttagttttaccgccagcgattatggcgcgtatg
gcaaccactatcgattccatttctaacggccgctttggcgtgaacttagttaccgggtgg
cagcgccccgagtactcccaaatgggcatgtggcctggcgacgaattctttggtaatcgc
tatgagtaccttgatgaatacatcacggtggttaaagagttgtgggaaacgggaaaaagt
gattttaaaggcgagcacttccaaatggatgactgccgaatgctgcctaaacctcagcgt
aagataccgcttatctgcgcgggccaaagtgccgcgggcatggatttctctgcccgtcat
gccgactataacttctgctttggcaaaggtgtgaatacgcccaccgcattcgcacctacc
gcagcccgtttaaccgaagcggcggaaaagcacggtcgtagcgtaggttctgcggtactt
gttatggtcattgccgatgaaaccgacgaaaaagccatggcaaagtgggaaagctataaa
gacggaaaagatcagtcggcattagattggatggcaacccaaggtgccgctgataagaag
tcgggcaaagacactaacattcgcgatatgaccaaccccacgtctgcagttaacctgaat
atgggaacgctagttggctcgtatgcgtcggtagcttcaatgctcgatgaaattgcgacg
gttccgggttgtgaaggggtactgctaacgtttgatgatttcttaaaaggtatggatgac
ttcggtactaaaattcagccactgatgaaatcgcgccagcacctgctaaacacatcagga
gctgcctaa

DBGET integrated database retrieval system