KEGG   Alteromonas mediterranea U8: I634_16595Help
Entry
I634_16595        CDS       T02722                                 

Definition
(GenBank) sterol desaturase
Organism
amao  Alteromonas mediterranea U8
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FA_hydroxylase
Motif
Other DBs
NCBI-ProteinID: AGP95003
Position
3789218..3790111
Genome map
AA seq 297 aa AA seqDB search
MNYQWAILAVFITFALLEAKNGKLFKKSSEVSDDGKVELIGTLLLFVVTQPFVLFSSAAI
MALAFPQIQGALADSPVLIHIALLLIFDDMMQYWWHRLSHSTRFLYNLHRAHHNAKYMSV
RIIYRNNFFYYLFMPSLWFSGALIYLGLGWTYAFYLVVKLTVITGAHAEWKWDRLLYQTP
WLHPIAWVVERTISTPSTHSAHHGLKADDGITNYKGNYGNLLFFWDVLFGTAKITRQYPA
QYGIEGMFYANWKEQLIWPLYKTPRKPKRVQTETVHTHAPPPASESQTMHHAVKGKA
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgaattatcagtgggcaattttggcggtgttcatcacctttgcgctgttggaagcaaaa
aacggtaagctatttaaaaagtccagcgaagtcagtgatgatgggaaggtagagcttatc
ggtacgttgctgttgtttgtggtaacccaaccttttgtcctgtttagttctgccgccatc
atggcgttagcctttcctcagattcaaggtgcacttgccgactcgccggtccttatacac
atcgcgctgctattgatattcgatgacatgatgcaatactggtggcatagactatctcac
tccacgcgctttctttataacttgcacagggctcaccacaacgccaaatacatgagcgtt
cgcatcatctacaggaacaactttttctattacttatttatgccttcgctgtggttttct
ggtgcactgatttatttagggctagggtggacttacgcattctatttggtggtcaagctt
accgtaatcacaggcgcacacgccgagtggaaatgggatagactgctatatcaaacgcca
tggctacatcccatagcttgggtggtagagcgcacaatatctaccccttcgacacacagt
gcccaccatggcttaaaagcggatgatggcattaccaactacaaaggtaattatggaaat
ctgttattcttttgggatgtgctatttggtaccgctaaaatcacgcgccaatatcctgcg
caatacggcatagaaggcatgttttacgctaactggaaagagcaactgatatggccgcta
tataagacgccgagaaagccaaagcgtgtacaaactgaaactgtccacacacatgcacca
ccgcccgcctcagaatcacaaacaatgcaccatgctgtaaaaggcaaggcctaa

DBGET integrated database retrieval system