KEGG   Alteromonas mediterranea U8: I634_16600Help
Entry
I634_16600        CDS       T02722                                 

Definition
(GenBank) hypothetical protein
Organism
amao  Alteromonas mediterranea U8
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: VF530
Motif
Other DBs
NCBI-ProteinID: AGP95004
Position
3790217..3790438
Genome map
AA seq 73 aa AA seqDB search
MNQQPNNPLHGLTLEKIVTQLHERYGWDGLYYRIKVNCFNNDPSIKSSLKFLRKTQWARD
KVEQLYIQTFSDK
NT seq 222 nt NT seq  +upstreamnt  +downstreamnt
atgaaccaacaacccaataacccacttcacggcttaaccctagagaaaatcgtcactcaa
cttcacgaacgatacgggtgggatgggttgtattaccgaatcaaggtgaactgctttaac
aacgacccctcgattaaatcgtcgctcaaatttttaagaaaaacacagtgggcaagggat
aaagtagagcaactttacattcaaacgtttagtgataaatag

DBGET integrated database retrieval system