KEGG   Alteromonas mediterranea U8: I634_16615Help
Entry
I634_16615        CDS       T02722                                 

Definition
(GenBank) DNA polymerase IV
  KO
K02346  DNA polymerase IV [EC:2.7.7.7]
Organism
amao  Alteromonas mediterranea U8
Brite
KEGG Orthology (KO) [BR:amao00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:amao03400]
    I634_16615
Enzymes [BR:amao01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     I634_16615
DNA repair and recombination proteins [BR:amao03400]
 Prokaryotic Type
  TLS (translesion DNA synthesis) factors
   Y-family DNA polymerases
    I634_16615
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IMS IMS_C IMS_HHH DNA_pol_lambd_f Cdd1 NAC
Motif
Other DBs
NCBI-ProteinID: AGP95007
Position
complement(3791773..3792846)
Genome map
AA seq 357 aa AA seqDB search
MRKIIHVDMDCFYAAVEMRDNPALRNIPIAIGGSADRRGVISTCNYPARKFGVRSAMATA
YALKLCPNLTLVKGRMEVYAAESQKIRKIFADYTDLIEPLSLDEAYLDVTNSEFCGGSAT
LIAEEIRARIESELGLTASAGVAPCKFVAKVASDENKPDGICVITPDKLDAFVREMPLKK
IPGVGKVTMQKLQRMGLNTCNDVRQYPFERIQKELGKFGSVLWERAHGIDERELSVSRER
KSIGVERTLSEDIHTIEQCIDFLPHLFEKLQERMDNHKKRTGKPVRIRTQGVKLKFNDFQ
LTTVEHRCATLDEAYFRTLMQEAFERATGRGIRLVGVHIGLAADQSTQQLVLPFEST
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgcgaaaaattatccacgttgacatggattgtttttacgccgcagttgaaatgcgcgac
aacccagctttgcgcaatattcccatcgctattggcggcagtgccgaccgacgcggtgtt
atctctacctgtaattatcccgcccgtaaatttggtgtgcgctcggctatggcaacagcc
tatgccttaaagttatgtcccaatcttactttagtgaaaggccgcatggaggtgtatgcc
gctgagtcgcaaaaaatacgtaaaatttttgcagactataccgaccttattgaaccccta
tcattagatgaagcctatctggacgttaccaacagtgaattttgtggtggcagcgctacg
ttaatagctgaagaaatacgtgctcgtattgaaagcgagttgggtcttaccgcttcagca
ggggtcgcgccctgcaaattcgtggcaaaagtagccagcgatgaaaacaagcccgacggc
atctgcgtgataactcccgataaactcgatgcgtttgtacgcgaaatgccgctaaagaaa
attcctggcgtgggcaaagttaccatgcaaaagctgcagcgcatggggcttaatacctgc
aatgacgttcgtcagtatcctttcgaacgtattcagaaagagctaggtaaattcggtagt
gtgctgtgggaacgggctcacggtattgatgagcgagagttgtcggtatcacgagagcgc
aagtctataggcgtagagcgtacgctaagcgaagatatccacactatcgagcaatgcatc
gactttttgccccatttgtttgaaaagcttcaagagcgaatggataatcacaaaaagcga
acgggtaaaccggtacgcattcgcacgcagggcgtgaagcttaagttcaatgactttcag
ctaaccacggtcgagcatcgctgtgcaacccttgatgaagcgtattttcgtacactcatg
caggaagcctttgaacgagcaacagggcggggtattcgacttgtgggcgttcacataggc
ctcgccgccgaccaatcaacacaacagctggttttgccttttgaaagtacttag

DBGET integrated database retrieval system