KEGG   Alteromonas mediterranea U8: I634_16625Help
Entry
I634_16625        CDS       T02722                                 

Definition
(GenBank) hypothetical protein
  KO
K07154  serine/threonine-protein kinase HipA [EC:2.7.11.1]
Organism
amao  Alteromonas mediterranea U8
Brite
KEGG Orthology (KO) [BR:amao00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:amao01001]
    I634_16625
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:amao02048]
    I634_16625
Enzymes [BR:amao01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     I634_16625
Protein kinases [BR:amao01001]
 Serine/threonine kinases: Other
  Bacterial family
   I634_16625
Prokaryotic defense system [BR:amao02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   HipA-HipB
    I634_16625
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HipA_C Couple_hipA
Motif
Other DBs
NCBI-ProteinID: AGP95009
Position
3793823..3795076
Genome map
AA seq 417 aa AA seqDB search
MSRVTAEVYASWFPIKEPVFAGHLLFQETSRGGVFSFEYDSDFLKSPFRMQLDPSLALTS
GEHYNDRSDRNFRVFLDSCPDRWGELLMKRRAALDFKNGHRETARMTAMDYLLGVHDSYR
MGGLRFKTSPEGNFVDDNVEYAAPPMASLKQLEYASMMIENDENIDSDEYYRWLSMLIAP
GSSLGGARPKACAQDDNNDLWIAKFPNSNDTTDVGAWEMACHKLALDAGIDMYPCDIQKF
NSTHHTFITKRFDRDKGQRIHFSSAMTQLQYYDGRGETEDASYLELAEFLTVNGSQTQKD
LAQLWRRIVFNIAVSNTDDHLRNHGFLLTKKGWALSPAYDLNPSIDKTGLHLNIDDMSND
LDYGLAFSVADYFNLKKSEANKIYDEVMHSVKNWEAIASSIGISRQEQLGMQEAFRV
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgagtagagtaacggctgaagtttatgcttcttggtttccaataaaagaacctgttttt
gctggccaccttttatttcaggaaacatcacgaggtggcgtttttagctttgaatacgat
agtgattttttaaagtctccgtttcgcatgcagctcgacccgtcactagcattaacttca
ggggagcattataacgatagaagtgataggaacttccgcgtgtttctagattcttgccca
gaccgttggggcgagttattgatgaaacggcgtgcagctctcgattttaaaaatggccac
agagaaaccgcaagaatgacagccatggattatttacttggcgttcatgactcctaccgg
atgggaggtttacgattcaaaacatccccagagggcaatttcgtagatgacaatgttgag
tatgccgcaccgccaatggcgtcactgaaacaactagagtatgcctcaatgatgatcgaa
aacgatgaaaacattgatagtgacgagtattaccgttggttaagcatgctcattgcgccg
ggctcttcattaggtggtgctcgccctaaagcatgtgcgcaagatgacaataatgatttg
tggatagccaagtttcccaatagtaacgacactacagatgtcggcgcttgggaaatggcc
tgccataagctagcccttgatgctggcattgacatgtatccatgtgatattcaaaagttt
aactcgactcatcatacgtttatcactaaacgatttgaccgagataaaggtcagcgaata
catttttcatcagccatgactcagcttcaatactacgacggcagaggcgaaacagaagat
gcgagttacctagagttagcagaattcctaaccgtgaatggctcgcaaactcaaaaagac
ttagcgcagttgtggcgccgtattgtgtttaatattgcagtatctaataccgatgaccat
ttacgcaatcacggcttcttactgactaaaaaaggttgggcactgtcacctgcttatgat
ttaaacccgtctatcgataagaccggcttacacctaaacatagatgacatgtcaaatgac
ctggattatggcttagcatttagtgtcgctgattactttaatttaaaaaaatctgaagct
aataaaatctatgacgaagtgatgcactcagtgaaaaactgggaagcgatagcatctagt
atcggaattagtaggcaagaacagcttggaatgcaggaagcatttagggtttag

DBGET integrated database retrieval system