KEGG   Alteromonas mediterranea U8: I634_16635Help
Entry
I634_16635        CDS       T02722                                 

Definition
(GenBank) thiamin biosynthesis lipoprotein ApbE
  KO
K03734  FAD:protein FMN transferase [EC:2.7.1.180]
Organism
amao  Alteromonas mediterranea U8
Brite
KEGG Orthology (KO) [BR:amao00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    I634_16635
Enzymes [BR:amao01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.180  FAD:protein FMN transferase
     I634_16635
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ApbE
Motif
Other DBs
NCBI-ProteinID: AGP95011
Position
complement(3795420..3796445)
Genome map
AA seq 341 aa AA seqDB search
MIRFAIRIFLAFFAIGILVLASCSDEKAPVVHLQGQTMGTTYNVKYLVGKEPVEGLQAEI
DARLVEVNKMMSTYDPTSELSRFNQYRYTDNFAVSPDTLTVVNEALRLASLSGGVLDVTV
GPLVNLWGFGPTKRPEKVPSQGEIDEIRDYVGYQKLSTTPTGLKKSHPMLYVDLSTIAKG
FGVDEVAEILEKHGIENYLVEIGGEMRVKGERGDGSEWLIAIEKPVTTERAVQKVVSIGE
NAVATSGDYRNYYEEDGVRYSHLIDPTTGKPISHNLVSVTVVHPSSMTSDGLATAFNVMG
WEQAISVAEQEQLAVFLIRRTEDGFEEYASPEFDKLVTVHN
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
gtgattcgtttcgcaattcgaatttttctcgctttttttgcaataggcatattagtactt
gcaagctgtagtgatgaaaaagcgcctgtagtacatcttcagggccaaacaatgggtaca
acctacaacgttaaataccttgtaggtaaggagccggtagaagggttacaggctgaaata
gacgcacgtcttgttgaagtaaacaagatgatgtcaacgtatgaccctacatcagaactt
tcaaggttcaatcagtatcgctataccgataactttgccgtatcgccagacactttgacc
gtggttaatgaagcgttgcgtttagctagcttaagcggcggtgtgcttgatgtaacggtg
ggccctttggtgaacttgtgggggtttggcccaacaaaacgccccgagaaagtaccaagc
caaggggagatcgacgaaattagagactatgtgggttatcagaaactgtcgaccacgcca
accggtctcaaaaaaagccaccccatgctctacgtcgatttatcgaccatagccaaaggt
tttggtgtagatgaagtggcagagatccttgaaaagcacggtattgaaaactaccttgta
gaaataggcggtgaaatgcgcgtgaaaggtgaacgtggcgacggcagcgagtggcttatc
gctattgaaaagccggttactactgaacgcgcagttcaaaaagttgtctccataggtgaa
aacgcggttgctacgtcgggcgactatcgtaactattacgaagaagacggggttcgttat
tcgcacctaatagacccgactaccggtaaacctatttcgcataatttggtatcggtaacc
gttgtccacccttcatctatgacgtcagatggtttagctacagcgttcaacgtaatggga
tgggagcaagcaatatcggttgctgagcaagaacaacttgctgtattcctcattcgtcgc
acagaagacggatttgaagagtatgcatcgccagaatttgataaactggtcacagttcat
aattag

DBGET integrated database retrieval system