KEGG   Alteromonas mediterranea U8: I634_16655Help
Entry
I634_16655        CDS       T02722                                 

Definition
(GenBank) Na(+)-translocating NADH-quinone reductase subunit C
  KO
K00348  Na+-transporting NADH:ubiquinone oxidoreductase subunit C [EC:1.6.5.8]
Organism
amao  Alteromonas mediterranea U8
Brite
KEGG Orthology (KO) [BR:amao00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    I634_16655
Enzymes [BR:amao01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.5  With a quinone or similar compound as acceptor
    1.6.5.8  NADH:ubiquinone reductase (Na+-transporting)
     I634_16655
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FMN_bind
Motif
Other DBs
NCBI-ProteinID: AGP95015
Position
complement(3799071..3799835)
Genome map
AA seq 254 aa AA seqDB search
MSAKKESLGKTIGVVVAVCLVCSIVVSGAAVGLRSLQQTNAALDKKSNILNAAGLYEMGM
SNNAIESTYSERVEQRYVNLEEGTFVEAPAPDYDMYKAAKQTEYSTKVTNSNVGFQRRPN
VASVYLVRNEAGDVSRIILPVHGSGLWDLMYGFLAIDADGQTVRELIYYQQKETPGLGGE
VQNPAWQDKWDGKELYENGEVAIRVVKNANPSNPHTIDALSGATLTSNGVENTIRYWVGE
QGFGQFLKNQAWRS
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
gtgtcggctaagaaagaatctttaggcaaaactatcggtgtagtagtagccgtatgtttg
gtttgttcaattgttgtttctggcgcggctgttggccttcgctctctacagcaaacaaac
gcggctcttgataaaaagagcaacattcttaatgctgcaggcctttacgaaatgggcatg
agcaataacgctatcgaaagcacgtacagcgagcgagtagagcagcgttacgttaatctt
gaagaaggcacgtttgttgaagcgcctgcgccagattacgacatgtataaagctgctaag
cagactgagtacagcacaaaggtaactaacagcaatgtaggtttccaacgtcgccctaac
gtggcaagtgtttacttagtgcgcaacgaagcaggtgatgtatctcgtatcatccttcct
gttcacggtagcggtctttgggatcttatgtacggattcttagcgatagatgcagacggc
caaacggttcgcgagcttatttactatcagcaaaaagaaacgccaggactaggtggtgaa
gtgcaaaaccctgcttggcaggacaaatgggacggcaaagagctttacgagaatggcgaa
gttgctattcgcgtagtgaaaaatgctaaccctagcaatcctcacactatcgatgcgctt
tcaggtgcaaccctaaccagcaacggtgttgaaaacactattcgttactgggtaggcgag
caaggcttcggccagttcctgaagaaccaagcatggcgttcataa

DBGET integrated database retrieval system