KEGG   Alteromonas mediterranea U8: I634_16680Help
Entry
I634_16680        CDS       T02722                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
amao  Alteromonas mediterranea U8
Pathway
amao00620  Pyruvate metabolism
amao00680  Methane metabolism
amao01100  Metabolic pathways
amao01120  Microbial metabolism in diverse environments
amao01200  Carbon metabolism
Module
amao_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:amao00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    I634_16680
  09102 Energy metabolism
   00680 Methane metabolism
    I634_16680
Enzymes [BR:amao01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     I634_16680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 T4_tail_cap DUF1383
Motif
Other DBs
NCBI-ProteinID: AGP95020
Position
3805242..3807863
Genome map
AA seq 873 aa AA seqDB search
MQTHYDAELKDTVRYLGKTLGETIKNQLGQEWLDRIEKIRKGGRASYQGDATCSEELKET
FKTMSDSDLLTVGRAFAQFLNLGNIAEQEYNAAMNVDASIDALFKHLDKAELTADKVQDA
VAKLNIDLVLTAHPTEVTRRTLIHKHKELADCLQAVHQESLSDVERKKVETRIADLIAQA
WHTEEIRSVRPTPVDEARWGFSVIENSLWEAVPDFMRELDGRLNEDYDVSLPLDSSPVQF
SSWMGGDRDGNPFVTSKVTEQVLLLARKRAAKLFAIDLDRLQVELSMYDCNEELRDKVGD
ANEPYRALLRPLVNKFIATRDGIADYLAGKNPDTSNWIESDDELIEPLMLCYQSLIDCGM
QVVANGLLLDTIRRARVFGIHLLRLDVRQDSERHADVFSELTRYLGLGDYAQWSEADKQA
FLLRELGSKRPLFPAQWDASDDVKEVLDTCKVIAKHSKHGFGIYIISMASEPSDVMAVQL
LLQESGVDWPMPVAPLFETLDDLNNSPDVMRKLLSIDWYRGYVKGRQFVMIGYSDSAKDA
GALAAGWAQYQSQEALVAIAEEFDVSLTLFHGRGGTIGRGGLPAHAAIYSQPPGSLEGGF
RVTEQGETIRYKFGMPKLAKRSLGIYASAIIEAMLFPPPAPKEEWRELITTMAAQGRDNY
RATVRHDEEFVPYFRVATPEQELGKLPLGSRPAKRKPQGGIESLRAIPWIFAWAQTRLVL
PSWLGVMRAIDSVKTPENEKVVNEMFSEWPFYRSRLSMLDMVFHKADPRISEAYDERLVP
KELKHFGEALRSELKESISSLLAITGDDDIMKNDPQGKESMEIRAGYLQPLHYLQIELLD
RIRKAGDDAQNTSLERAMMVTIAGIAIGMRNTG
NT seq 2622 nt NT seq  +upstreamnt  +downstreamnt
atgcaaacacactacgatgctgaactgaaagataccgttcgataccttggtaaaaccctt
ggtgaaacaatcaaaaatcaattaggtcaggagtggctagaccggattgaaaagattcga
aaaggcggccgagcttcttatcagggagacgctacttgtagcgaagaactgaaagaaact
ttcaaaacaatgtctgacagcgatttgcttactgttggtcgtgccttcgcacaattcttg
aacctaggtaatattgccgagcaagaatacaacgcggcaatgaatgttgatgcatctatt
gatgcccttttcaaacacctagataaagcagaactaactgctgacaaagtacaagacgcc
gttgcaaaactaaacatcgatcttgtattaaccgcgcaccctactgaggttacgcgccgt
acacttattcataaacacaaagagctagcggattgcctgcaggctgtgcatcaagaatcg
ttaagtgatgttgagcgtaaaaaggtagaaacacgcattgctgaccttattgctcaagct
tggcacactgaagaaattcgttccgttcgcccgacccctgttgatgaagcgcgttggggc
ttctcggtcattgaaaactcattgtgggaagcggtacctgacttcatgcgcgagctagat
ggccgcttaaacgaagactacgacgtatcactaccgctagactcgtcaccagtacaattt
agctcttggatgggtggagacagagacggcaacccatttgttacttcaaaagtaactgag
caagtactgctgcttgctagaaagcgcgcggctaagcttttcgctatcgaccttgatcgt
ttgcaagtagaactttcaatgtacgattgcaacgaagaactacgtgacaaagtaggcgat
gcaaacgaaccgtaccgcgccctacttcgcccgctggtaaacaagtttattgcgactcgc
gatggcattgccgactacttggccggcaagaatccagacacgtctaactggattgaaagc
gacgacgagcttatcgagccgctaatgctttgctaccagtcattaatcgactgcggtatg
caagtagtggcaaacggccttctactagatactatccgtcgtgctcgtgtattcggtatt
caccttcttcgccttgacgtacgtcaagattctgagcgtcacgccgacgtatttagtgag
ctaactcgctacctaggtttaggcgactacgcccagtggagcgaagccgacaagcaagcg
ttcttattacgtgagcttggctcgaaacgtccgttattcccagcgcaatgggatgcatct
gacgatgtaaaagaagtgctagatacctgtaaggtgattgcgaaacacagcaagcacggc
ttcggtatttacattatctctatggcgagtgagccatcggatgtcatggcggttcagctg
cttcttcaagaaagcggtgtagactggccgatgccggtagcaccactatttgaaacgctt
gacgatttgaacaactcaccagatgtaatgcgcaaactcctgtctatcgactggtatcgc
ggttacgtgaagggccgtcagttcgttatgatcggttactctgattcagcgaaagatgca
ggcgcattggctgctggctgggcacagtatcagtcgcaagaagcattggttgccattgca
gaagaattcgacgtaagcctaaccctgttccacggacgtggcggtacgattggtcgtggt
ggattgccagcacatgcggcaatttactcacagcctcctggctcactagaaggcggtttc
cgcgtaacagaacagggcgaaactattcgctataagttcggtatgccaaaactggctaaa
cgcagcctaggtatttacgccagcgccattattgaagccatgttgttcccacctccggca
ccaaaagaagagtggcgtgagcttattaccaccatggcagcgcaaggtcgtgataactac
cgtgcaactgtacgtcacgatgaagagtttgtaccttacttccgcgtggctactccagag
caagagctaggtaaactacctctaggcagccgccctgctaagcgtaaaccacaaggcgga
attgagagcttacgtgctatcccatggatcttcgcttgggcacagacacgtttagtgctg
ccaagctggttgggcgttatgcgcgctattgatagcgtgaagactcctgagaacgagaaa
gtggttaacgagatgttcagcgaatggccgttctatcgttcacgcctttctatgttagac
atggtgttccacaaagctgacccacgcattagcgaagcttatgatgagcgcttggtaccc
aaagaacttaaacactttggtgaagcattgcgtagcgagcttaaagaaagcatctcttca
ctgctggctatcacaggcgatgacgacattatgaagaacgacccgcagggtaaagaatcg
atggagatccgcgcaggataccttcagccacttcattaccttcaaatcgagcttcttgat
cgtattcgtaaagccggtgatgacgcacaaaacaccagcctagagcgcgccatgatggta
accattgccggtattgctatcgggatgcgtaacacgggttaa

DBGET integrated database retrieval system