KEGG   Alteromonas mediterranea U8: I634_16695Help
Entry
I634_16695        CDS       T02722                                 

Definition
(GenBank) malate dehydrogenase
  KO
K00024  malate dehydrogenase [EC:1.1.1.37]
Organism
amao  Alteromonas mediterranea U8
Pathway
amao00020  Citrate cycle (TCA cycle)
amao00270  Cysteine and methionine metabolism
amao00620  Pyruvate metabolism
amao00630  Glyoxylate and dicarboxylate metabolism
amao00680  Methane metabolism
amao01100  Metabolic pathways
amao01110  Biosynthesis of secondary metabolites
amao01120  Microbial metabolism in diverse environments
amao01130  Biosynthesis of antibiotics
amao01200  Carbon metabolism
Module
amao_M00009  Citrate cycle (TCA cycle, Krebs cycle)
amao_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
amao_M00012  Glyoxylate cycle
amao_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:amao00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    I634_16695
   00620 Pyruvate metabolism
    I634_16695
   00630 Glyoxylate and dicarboxylate metabolism
    I634_16695
  09102 Energy metabolism
   00680 Methane metabolism
    I634_16695
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    I634_16695
Enzymes [BR:amao01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.37  malate dehydrogenase
     I634_16695
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ldh_1_C Ldh_1_N NAD_binding_10
Motif
Other DBs
NCBI-ProteinID: AGP95023
Position
complement(3811478..3812416)
Genome map
AA seq 312 aa AA seqDB search
MKVAVLGAAGGIGQALSLLLKTQLPAGSDLALYDVAPVVPGVAVDLSHIPTAVKVTGHGK
DDLADALTGADVVLIPAGMPRKPGMDRSDLFNINAGIVKNLIEGVADNCPNACVGIITNP
VNTTVAIAAETLKAKGVYDKNKLFGVTTLDVIRAETFVAELKDVDVSSVHVPVIGGHSGT
TILPLLSQVEGVEFTDEEVSSLTTRIQNAGTEVVEAKAGGGSATLSMGQAAARFCLSLVA
AMQGENVVEYTYVQTDDSDDAAFFAHPVRLGANGVEEILPYGELSAFEEKAKNDMLEGLR
GDIKLGVDFVNG
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtagccgtgttaggtgctgccggtggtattggtcaggcgctgtctttgttgttg
aaaacacaattgccagcaggttcagatttagcgctttacgacgtagcgccagttgttcct
ggtgttgccgttgatttgagccacatccccactgcggtaaaagtaaccggtcacggtaaa
gatgacctagctgatgcactaactggagcagacgttgttctaattccagcgggtatgcct
cgtaagccaggtatggatcgttctgatctgttcaacatcaacgccggcattgttaaaaac
ctaatcgaaggtgtagctgataactgcccgaacgcgtgtgttggtatcatcactaaccca
gttaacactactgttgcgattgcagctgaaacgctaaaagcaaaaggcgtttacgacaag
aacaagcttttcggtgtaacgacacttgacgttatccgtgctgaaactttcgttgctgaa
cttaaagatgtagacgtatcttctgtgcacgtaccggtaatcggtggtcactctggtaca
actatccttcctcttctttcacaagttgaaggcgtagagtttacagacgaagaagtatct
agcctaactactcgtatccaaaatgcgggtactgaagttgttgaagcgaaagcgggcggc
ggctctgcaaccctttcaatgggtcaagcagcagcacgcttctgtctatctctagttgca
gcaatgcaaggtgagaatgtggttgagtacacttatgtacaaactgacgacagcgacgac
gcagcattctttgcacacccagttcgcctaggcgcaaacggtgttgaagaaatcttgcca
tacggcgagctaagcgcgtttgaagaaaaagcgaaaaacgacatgcttgaaggcctacgt
ggtgacatcaagctaggcgtagacttcgtaaacggctaa

DBGET integrated database retrieval system