KEGG   Alteromonas mediterranea U8: I634_16725Help
Entry
I634_16725        CDS       T02722                                 

Definition
(GenBank) uridine kinase
  KO
K00876  uridine kinase [EC:2.7.1.48]
Organism
amao  Alteromonas mediterranea U8
Pathway
amao00240  Pyrimidine metabolism
amao01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:amao00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    I634_16725
Enzymes [BR:amao01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.48  uridine kinase
     I634_16725
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PRK AAA_18 AAA_33 Zeta_toxin KTI12 APS_kinase dNK AAA_16 CbiA AAA_22 MobB Pox_A32 AAA_28 NB-ARC Sigma54_activat Torsin ABC_tran KAP_NTPase RNA_helicase T2SSE DUF2075 ATPase
Motif
Other DBs
NCBI-ProteinID: AGP95029
Position
3819675..3820328
Genome map
AA seq 217 aa AA seqDB search
MHQQNQLYSTMQSPLIIAISGASGSGKSLFTKNLFNGFSAQGRPVQVLREDHYYRAQDHL
PMEQREKNNYDHPNAFEHELLKAHLQALRDGQPIDYPHYCYKTHTRLPETERLNPAPVII
LEGIMLLARTDLLPLYDVKIFIDTPLDICLMRRMMRDLKERGRSIESVAKQYEETVKPMY
HQFIEPSRFTADVVVTQGGKNQIALDVIKSHIQQALL
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
ttgcaccaacaaaaccagctttatagtactatgcaatcgccacttattattgccatttct
ggggcttcgggctctgggaagtctctttttacaaaaaatttgttcaacggcttcagtgcc
caaggacgtcccgttcaagtgctgcgcgaagatcactactatcgtgcgcaagatcatctt
cccatggagcagcgtgagaagaacaattatgatcaccccaacgcctttgaacatgagctt
ttaaaagcgcacttacaagcattgcgtgacggtcaacctatcgactacccacattattgc
tataaaacgcacacacgtttacctgaaacggagcgtttaaaccccgcaccggtaataata
cttgaaggtatcatgttgctagcccgtaccgacttactacccttgtacgacgttaaaatt
ttcatcgataccccactagatatttgtttaatgcgcagaatgatgcgtgaccttaaagaa
cgtggtcgcagtattgaatctgtggcaaaacagtacgaagagactgttaagccaatgtat
catcaatttatcgaacctagccgcttcactgccgacgtagtagtgacgcaaggtggcaaa
aaccaaattgcattagatgtgattaaatcacacattcagcaagcgcttctttaa

DBGET integrated database retrieval system