KEGG   Alteromonas mediterranea U8: I634_16740Help
Entry
I634_16740        CDS       T02722                                 

Definition
(GenBank) hypothetical protein
Organism
amao  Alteromonas mediterranea U8
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPR_2 TPR_1 TPR_19 TPR_14 TPR_16 TPR_7 TPR_11 TPR_12 TPR_8 TPR_9 TPR_17 TPR_10 ABC2_membrane_3 ANAPC3
Motif
Other DBs
NCBI-ProteinID: AGP95032
Position
complement(3822627..3823784)
Genome map
AA seq 385 aa AA seqDB search
MNARILVTILFCFVVGGCTSTNNNQADATPILLNDSLFPSFSLFPVEPLEEIFYLDEDAQ
QFAEKAVHEKSILQKNVKGLVKAIFDHSDRGMLYRNSANTTANTTFNNRAANCLSLSIMT
LALAEHVGLTATFYEVDIPEYWTRREGFSLLNGHINLRISLPNESPVASVGGTWADVDFD
PQMLRNYFPRKAVSRDKVIAMFYNNKGADALVANSYTRAYSYFRAAAKISPALQQTWVNL
GVLYRMVDEYEQAELAYKHALALDDENLTAWENLSILYTYQNKDDAALKITQMVEAKRKN
NPFYHYILGEQAFEAGKADVAITHYERGLRLDNARHELLFGMAKAFHELGDVSKATRYLK
HAVKHSPNEQEKQRYSSKLASLASR
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgaatgctcgaattcttgtaacaatactgttttgttttgtagttggtgggtgcacgtct
actaataacaatcaggcagatgctacaccaatattattaaacgatagcctctttccctct
tttagtttgtttcccgtcgagccgctcgaagagattttttacttagatgaagacgcacag
caatttgcagaaaaagccgtgcatgaaaaaagcattttacaaaaaaatgtgaaagggtta
gtaaaggccattttcgatcattctgaccgcgggatgctttatcgaaacagtgccaatact
acagcaaataccacgtttaataaccgcgctgccaattgcctttcattgtctattatgact
ctggcgttagctgaacacgttgggcttaccgccactttttatgaagtagatatcccagag
tattggactcgccgtgaaggatttagcttgcttaacgggcatattaatttgcgtatttca
ctacctaatgaaagccctgtagcctcggttggcggaacgtgggcagatgtagatttcgac
cctcaaatgttacgcaattacttcccaagaaaggcagtatcgagagacaaggttatagct
atgttttacaacaataagggcgctgacgctttagtggcgaacagttatacccgagcctac
agctattttagagccgcagccaaaatctcccctgcgttacagcagacctgggtaaatttg
ggcgttttgtaccgaatggttgatgagtatgagcaagctgagttggcctacaagcatgcg
ttagcactggacgatgaaaacttaacggcatgggaaaacttatcgattctttatacctat
caaaataaagatgatgcggccctaaagataactcaaatggtagaggcaaaacgtaaaaat
aacccgttttatcactatatcttaggtgagcaggcctttgaggctggaaaagccgatgtg
gcaataacccattacgagcgagggcttaggcttgataacgcacgtcatgaactattgttt
ggaatggcaaaagcatttcatgagctaggtgatgtgagtaaagcaacgcgttatcttaag
cacgcagttaagcattctccgaacgagcaagaaaaacagcgttattcgtctaaattagcg
tcgttggctagtcgctaa

DBGET integrated database retrieval system