KEGG   Alteromonas mediterranea U8: I634_16745Help
Entry
I634_16745        CDS       T02722                                 

Definition
(GenBank) hypothetical protein
Organism
amao  Alteromonas mediterranea U8
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MAPEG
Motif
Other DBs
NCBI-ProteinID: AGP95033
Position
3824066..3824485
Genome map
AA seq 139 aa AA seqDB search
MFAVYTYSIAGLLLIIFTVFVQNIVAAIAHRRQSQYIPGKVSDELSHDSFVFRSHRTFHN
SLENVHQFTLPAILCMFLGAPTTLLALLIWIYALCRIMHMGLYYAIATEKNPSPRSYFYM
IGVLCTVGVFGLAIFQLFM
NT seq 420 nt NT seq  +upstreamnt  +downstreamnt
atgttcgctgtctatacctatagcattgccggcctgttactgattatttttactgtgttt
gttcaaaacatcgtggccgccattgcacacagaagacaatcccagtatatcccgggtaaa
gttagtgatgagttaagtcatgatagttttgtatttagaagccaccgaacctttcataat
tcgttagagaacgtacaccaatttacgcttcctgccattctatgcatgtttttaggcgca
ccaacaacgctattagcgttactaatatggatatatgcattatgccgaataatgcatatg
gggctatactacgcaatagctacggaaaaaaaccctagccccagaagctatttctacatg
attggcgtgctttgtacagttggcgtgtttggacttgcgattttccaattatttatgtag

DBGET integrated database retrieval system