KEGG   Alteromonas mediterranea U8: I634_16755Help
Entry
I634_16755        CDS       T02722                                 

Definition
(GenBank) DNA polymerase
  KO
K02342  DNA polymerase III subunit epsilon [EC:2.7.7.7]
Organism
amao  Alteromonas mediterranea U8
Pathway
amao00230  Purine metabolism
amao00240  Pyrimidine metabolism
amao01100  Metabolic pathways
amao03030  DNA replication
amao03430  Mismatch repair
amao03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:amao00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    I634_16755
   00240 Pyrimidine metabolism
    I634_16755
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    I634_16755
   03430 Mismatch repair
    I634_16755
   03440 Homologous recombination
    I634_16755
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:amao03032]
    I634_16755
   03400 DNA repair and recombination proteins [BR:amao03400]
    I634_16755
Enzymes [BR:amao01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     I634_16755
DNA replication proteins [BR:amao03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     I634_16755
DNA repair and recombination proteins [BR:amao03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   MMR (mismatch exicision repair)
    DNA polymerase III holoenzyme
     I634_16755
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNase_T DNA_pol_A_exo1
Motif
Other DBs
NCBI-ProteinID: AGP95035
Position
complement(3825603..3826283)
Genome map
AA seq 226 aa AA seqDB search
MIKQFIQACASVFFDKNRFKAKLRERYVGKTSFAAIDLELTSLQPSKTQITSLGYVEGKG
MRISLASSGYHVINTRADLGQSPVIHGLTQDILERGEELDEALRHLLPLLKRNILIFHNA
KLDLMALDRAFKQNNLQTVEVIYIDTLQLALYQLNKQHQVLPNNSATLTVCRQRLDLPAF
PAHNALDDALATLQLFFAQLNELGVTGEDSLKALLHTKAVGQYQLG
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgataaagcagtttatacaagcgtgcgcctcagtgtttttcgataaaaacaggtttaaa
gcaaagcttcgagaacgctatgtaggtaagacttcatttgccgctatcgatttagaactt
acctccctgcagccgtctaaaacacaaataacctcattgggttatgtggaaggtaagggg
atgcgaatttctcttgcatcaagcggatatcatgtaattaatacacgtgccgacttaggg
caaagcccggtcattcatggtttaacgcaagacatattagagagaggagaggagcttgac
gaagcactgcgtcacttactgccactactaaagcgtaatattctgatatttcataacgct
aaacttgacctaatggcacttgaccgggcgttcaagcagaataatttacaaacagtagag
gtgatttacattgataccctacaactggcgctatatcagttaaacaaacaacatcaggtt
cttcctaataatagcgctacgcttacggtgtgtcggcagcgcttagacttacccgccttt
cccgcccacaatgcattagacgatgcgttagccacgttacagttattttttgcccaacta
aacgaattaggggttaccggcgaagactcattaaaggcattgcttcataccaaggctgtg
ggtcaatatcaattaggctga

DBGET integrated database retrieval system