KEGG   Alteromonas mediterranea U8: I634_16760Help
Entry
I634_16760        CDS       T02722                                 

Definition
(GenBank) Signaling protein
  KO
K07182  CBS domain-containing protein
Organism
amao  Alteromonas mediterranea U8
Brite
KEGG Orthology (KO) [BR:amao00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    I634_16760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF294 DUF294_C CBS cNMP_binding GlnD_UR_UTase Polbeta
Motif
Other DBs
NCBI-ProteinID: AGP95036
Position
complement(3826289..3828130)
Genome map
AA seq 613 aa AA seqDB search
MTAMAKQVEDFLNTSAPFDVLDKEQKLELVKHTELIYVTSENVSDLYQENNALFLIQGGQ
FSIQDSDAPLRHLSEGDYFGYAGIMEQRSFPLSISVDSPGLVYRFDASAVSPLFEQPAIR
QFFNGLRDNALQSHAISDTNSMWLYKGLCDVIEKAPVSVNADTSISAAAQLMTTQKVSSL
LVTQNDKLTGIVTDRDLRSRVVAASLDTHLPVSEIMTQSPAQITGNRTLFDALALMTEKN
IHHLPVIDHQSLVPLGMVTASDIIRHQRGNVLFIIGELSKAENLYELTRLSWQLPHYFAA
HAKKAGDYDIAGKILSQATDIMTRKLIGFFQQANGKAPMMFAWLVYGSQAREDQTMGSDQ
DNGLLLAKAPTKAQADYFSKMSEYVCNGLAKCGIKLCDGNIMASNPALRLSLDEAIEEAR
HWVKAPTKDAIMHFNIFLDVRCAAGDVSLFKQLQKQRAPLMQQNMFLAALARHSNEISVP
LSMFQKFIYEKAKNDKQKEKDVIDLKTRAVALINNIARIYALADGITLPNTLARLDALSS
RSQLSKRDATNLRDIWLFLNRLRWRHQLENKVTDNRVSISSLSSIEKHQLKAAFKAIDRT
NQAMVMKFSGGVG
NT seq 1842 nt NT seq  +upstreamnt  +downstreamnt
atgacggcaatggctaaacaagtggaagacttcttaaatacgtctgcgcctttcgatgtg
cttgataaagaacagaaattggagctagttaagcacaccgagcttatttacgttacttcc
gagaatgttagcgacctttaccaagaaaataacgcactttttcttatacaaggtgggcag
ttctctattcaagattcagatgcgcctttgcgtcatttaagtgaaggcgactactttggc
tatgcggggatcatggagcagcgctccttcccgttaagtatcagtgtagacagccctggg
ctcgtttatcgtttcgatgcatcggctgtttcgcccttatttgagcagccggcgatacga
caattctttaatgggttaagagacaacgccctgcagagtcatgctatttctgatactaat
tcaatgtggctatataaagggctgtgtgatgttattgaaaaagcgcctgtatcggtaaat
gcagatacgtcgatttcagcggcggcacagctaatgacaacgcaaaaagtgtcgtcattg
ttggtaacacagaatgacaagcttaccggcattgttaccgatcgcgacttgagatcccgg
gtggttgcggcttcgttagatacccatttgccggtaagtgaaattatgacgcaaagccct
gcgcaaataactggaaataggactttgtttgatgcgctagcactaatgacagaaaaaaat
atccatcacctgcccgttatcgatcatcagtcactggtgcccttaggtatggtaacggcg
agtgatattattcgccatcaaaggggcaacgttctcttcattattggcgagcttagtaaa
gctgaaaacttgtatgaattgactcggctgtcctggcagctacctcactactttgctgct
cacgcaaaaaaagcgggggattatgatatcgccggaaaaattttgtctcaggccaccgac
attatgacaagaaagttgattggcttttttcaacaagccaacggcaaagcccctatgatg
tttgcttggcttgtgtatggttctcaggcaagagaagatcaaacaatgggctcagatcaa
gacaacggcttgttattggcaaaggccccgactaaagcgcaggctgactacttttccaag
atgtcggaatatgtttgcaatggcctagcaaagtgcggcataaagttgtgcgatggcaac
ataatggccagtaatcccgcgcttcggctgtcactagacgaggccatagaggaggcacgg
cactgggtaaaggcaccgacaaaagacgccatcatgcactttaatatctttcttgacgtg
cgctgcgccgcaggtgacgtcagcttgtttaagcagctacaaaaacagcgcgctcctctt
atgcaacaaaacatgtttttggctgctctggcaagacacagtaatgagatttctgttccg
ttatcgatgtttcagaagtttatttatgaaaaagcgaaaaacgacaaacaaaaagaaaag
gatgtcattgaccttaaaacccgagcggtagcgttaattaataatatagcccgtatttat
gcattggcggacgggatcacactacctaatacccttgctcgtttagacgcattatcatct
cgctctcaactgtcaaaacgagatgccactaatttgcgcgacatttggcttttcttaaac
agattgcgctggcgtcatcagttggaaaataaagtgaccgacaatagagtgtcgatatcg
agtctatcgtccatagaaaaacatcagcttaaagctgcgtttaaagccatagatagaacc
aatcaggcaatggtaatgaagttttctggcggcgtaggttaa

DBGET integrated database retrieval system