KEGG   Alteromonas mediterranea U8: I634_16765Help
Entry
I634_16765        CDS       T02722                                 

Definition
(GenBank) Na+/solute symporter
  KO
K14393  cation/acetate symporter
Organism
amao  Alteromonas mediterranea U8
Brite
KEGG Orthology (KO) [BR:amao00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:amao02000]
    I634_16765
Transporters [BR:amao02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   I634_16765
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SSF DUF2818
Motif
Other DBs
NCBI-ProteinID: AGP95037
Position
complement(3828234..3829940)
Genome map
AA seq 568 aa AA seqDB search
MDVQTLTFIIVGASFALYIAIAIWARAGSTNDFYVAGGGVPPVMNGMATAADWMSAASFI
SMAGLISFMGYDGAVYLMGWTGGYVLLALCLAPYLRKFGKFTVPDFIGDRYYSQTARTVA
VFCAIFVCFTYVAGQMRGVGVVFSRFLEVDIVSGVVIGMVIVFFYTVLGGMKGITYTQVA
QYCVMIFAYIVPAVFISMMVTGHILPQTGFGATLADGSGVHMLQKLDNLSVELGFNEYTS
GTKSTIDVFFITFALMVGTAGLPHVIVRFFTVPKVHDARKSAGYALAFIAILYTTAPSLA
AFARVNMIETINGPEMTGTSYAEAPSWIKNWEQTGLIAFEDKNGDGKMFYSGDERNEMKV
DRDIMVLANPEIANLPAWVIALVAAGGVAAALSTSAGLLLVISTSVSHDLLKRNFMPNIT
DKAELMYARLAAGVAIVIAGYFGINPPGFVAQVVAFAFGLAASSFFPAIIMGIFSKRMND
KGAIAGMISGIAFTAAYIIYFKFVNPAANTPDNWWFGISPEGIGTVGMLVNFIVAFLVFK
ATDEAPEEIQELVESIRYPKGAGEASAH
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
atggacgttcaaactttaacatttattattgttggcgcttcttttgcgctttacattgca
attgcaatttgggctcgcgctgggtctactaacgacttttacgttgctggtggcggcgtg
ccacctgtgatgaacggtatggctaccgcagcagattggatgtcggcagcgtctttcatc
tctatggctgggcttatctcatttatgggctatgacggcgccgtctaccttatgggctgg
accggcggttatgtattgttagcactctgtttagcaccttatttacgtaagttcggcaaa
tttacggtgcctgatttcatcggtgatcgttactactctcaaacggcacgtacggtggct
gtattctgcgcaatctttgtttgtttcacatacgtggcaggccaaatgcgtggggtcggt
gtggtatttagccgtttcttagaagtagacatcgtatctggtgtggttatcggtatggtt
atcgtgttcttttacaccgtattgggcggcatgaaaggcattacctatactcaggtagca
cagtactgcgtaatgatattcgcttacattgtaccagcggtatttatctctatgatggtg
acaggccacatcctgccgcaaacagggttcggtgccacacttgctgacggctccggcgtc
catatgctgcaaaagctcgataatttatccgtcgaacttgggtttaatgaatacacatcc
ggtaccaaaagtaccatagacgtattctttattacctttgcacttatggtgggtacagcg
ggtcttccacacgttatcgttcgtttcttcactgtgcctaaagttcatgatgcacgtaaa
tcagcaggttatgcattggcgttcattgctatcttgtataccactgctccttcgctagcg
gcattcgctcgggtcaatatgattgaaaccattaatggccctgaaatgacaggaaccagc
tacgcagaagcgccgtcttggattaaaaactgggaacagactgggctaatcgcctttgaa
gataaaaacggcgatggcaagatgttctattcgggtgatgagcgcaacgaaatgaaagtt
gaccgcgacatcatggtattggcaaaccctgaaattgcaaacctaccagcatgggtaatt
gcgttggttgcagcggggggagtggcagcagccctttctacatcggcaggcttgctgttg
gtaatttccacctctgtatctcacgatttgttgaagcgaaacttcatgccaaatattacc
gataaagccgagcttatgtatgcgaggttagctgcgggggtggcaattgttatcgcgggc
tacttcggtattaatccgcccggctttgtggctcaggtggtcgcctttgccttcggcttg
gctgcgtcgagtttcttccccgctatcatcatgggtatattcagcaaacgcatgaatgat
aaaggggccattgcaggcatgatttcaggtattgcctttactgcggcttacatcatttac
ttcaagtttgtaaacccagcagccaatacgcctgataactggtggttcggtatttcgcca
gagggcattggcacggtaggtatgctggtgaacttcattgtggcgttcctagtgtttaaa
gcaaccgatgaagcacctgaagaaatccaagagctggttgaaagcattcgttacccgaaa
ggtgcgggcgaagcgtcagctcactaa

DBGET integrated database retrieval system