KEGG   Alteromonas mediterranea U8: I634_16775Help
Entry
I634_16775        CDS       T02722                                 

Definition
(GenBank) hypothetical protein
Organism
amao  Alteromonas mediterranea U8
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PAS_7 HATPase_c Response_reg HisKA Glycos_transf_4 DUF3792 She9_MDM33
Motif
Other DBs
NCBI-ProteinID: AGP95039
Position
3830468..3833911
Genome map
AA seq 1147 aa AA seqDB search
MVFGWVTLAVLYLFLLFSLASWGEKNSPTARALTSHPAIYSLALAIYCTAWTFFGMVGQA
SRDTWIYLPIMLGPILVYVLGYKFIYKLTLVSKKQHITTISDFIASRYGKRQTVALVVTL
IALLATIPYIALQLKAVGATFQLLTQQPNSNGIIIAATGFIAAFAIYFGTRQTDVTEYRR
GLMLAIAFESTIKLLALVLVAAVGYSAWKRTQSGPFFESFTNEIALSQFGSFSFIAQTIM
AAAAIVCLPRQFHVAIIDNLSLGHLRTARWLFPLYLTVISAVIPIIAIAGKAIFANQGIE
PDSYVLSLAVFSESVLLQVIVFVGGLSAATAMIIVATLTLSTMLTNDVILPRILAFTGNT
DDKKDVSRKIRLIRRIVIAFILLMAFLYHQQMTSSRSLHSIGLIAFSLVIQLMPAIVGGL
YWKRAHAHGVYAGLMVGLVIWVLWLVLPIVSEQVSQMEQNELISQGAMISLAANSFVYIL
FSHFAPQRLIDRIQAEAFVSPAISSSNTVKTQATNVTVSDLITLLSTFMGSGRCEQLLDQ
YQHLNNCQLKHDDTPNESFLSFCERALGGVIGASSAKVLLDSALRGKKMDFTEVINFFDD
TTQAMQFNMTALLTSLENMDQGISVVDKHLNLVAWNKRYANLYPYPDNLLAVGTPIEKLI
RYNAAQGEFGTDNVDSEVEKRLSHLRSGMPHRFTRQRKDGRVIEMVGNPLPGGGFVTSFN
DITGHVEIQQALEESNIDLEARIKKRTEEVHSINAELRLEIERRSEAEKELIRARKAAED
ANASKTRFLALASHDVLQPLNAAKLYVSALEEQELPESSHAIIQKLGHSVTSSETLIGTL
LDIARLDQGEMKPDIESIDITALLSPLIDEMAMRAKEKGLGFKAIVRPCWVRADKTYLYR
ITQNLLSNAVKYTEKGRVLFIVKPIKNTVHFKILDTGIGISADKKDSIFGDFFRANESKE
HGLGLGLGVVRRLSLQLNSDIQVMSQIGKGSCFTFTLEKAEPKRVSSIVSKPRGTTFTGM
DVLCVDDQKENLDAMKTLLQKWGINVALANNWDDALTLCKTIQPQILLMDYQLSHDSEKN
GLALIEEIRHRLNIVVPAALITATPDESLVTQCKAQGVNFLAKPLKPAKLRALLQSMTRY
IREAKNV
NT seq 3444 nt NT seq  +upstreamnt  +downstreamnt
atggtctttggttgggtaacgcttgcagttctgtatctcttcttgctattttcattagcg
agttggggcgaaaagaattcacctactgcccgcgcactcacctctcacccggctatttat
tcactcgcgctcgctatttactgtacggcttggacgttctttggaatggtaggccaagca
agccgagatacatggatttacctacccattatgcttggtcccattttggtttatgtattg
gggtataagtttatttacaagctgaccctggtgagtaaaaagcaacacattaccaccatc
tcagactttattgcttcacgttatgggaagcgccaaaccgttgcgttagtagtaacactt
attgctttattggccaccattccctatatcgcacttcagttgaaggccgttggggcgact
ttccagttgttaacgcaacaaccaaacagcaacggcattattattgccgccaccggcttc
attgccgcttttgctatttactttggcacacgccaaaccgatgtcactgaataccgccgg
ggcttgatgttagccatagcattcgaatcgaccatcaaattactggctttggtgctagtg
gctgcggttgggtatagtgcatggaaacgaacccagtcagggccgttttttgaaagtttt
actaatgaaatcgccctctctcagtttggctcgttcagctttattgcacaaacgatcatg
gctgccgctgcaatagtgtgtttaccccgccagttccacgttgccattatcgacaattta
agccttgggcatttgcgcactgcgcgttggctctttcccttataccttactgttatttcc
gccgtgatcccgataattgctatcgcgggcaaagcgatcttcgccaaccaaggcatagag
cccgactcttacgtgttatcactggccgtattttccgagtcggtactgcttcaggttatt
gtatttgtgggcgggttgtccgcggcaacggcgatgatcattgtcgctacgctaaccctt
agcactatgttaactaacgatgttattttacctcgcatattagcgtttacgggcaacaca
gatgacaaaaaggacgtatcgagaaagattcgtttaattcgccgtattgttatagcgttt
attctacttatggcgtttttataccaccagcaaatgaccagcagccgctctcttcactct
atcggcttaattgccttctcgctggttattcagctaatgcctgccattgtgggcgggctg
tattggaagcgggctcatgcacacggggtatatgcaggcctaatggtaggcctagttatt
tgggtgctgtggctagtgcttcccattgtgagcgagcaagtatcgcaaatggagcaaaac
gagttaatcagccaaggcgccatgattagcttggcggcaaatagctttgtgtacatttta
ttttctcacttcgcgccccagcgtcttatcgatcgcattcaagccgaagccttcgtatct
cccgctatatccagcagtaacacagtaaaaacccaggcaacgaacgtaacagtatcagac
cttattactttactttctaccttcatgggatctggtcggtgtgagcagttgctagaccaa
taccagcaccttaataactgtcaattgaagcatgacgacacgcctaatgaatccttttta
tccttctgcgagcgtgcattaggtggtgttattggcgcatcgagcgcaaaagtgctgcta
gacagcgcgttacgtggtaaaaaaatggacttcactgaggttatcaacttctttgatgac
accacgcaggcaatgcaatttaatatgaccgcgcttttaacgtcgcttgaaaacatggat
caaggaatcagcgttgtcgacaagcatttaaacttagtagcgtggaacaagcgctacgct
aatctctacccttaccccgacaacttactcgcggtgggtactccaatagaaaagctcatt
cgatacaatgccgctcagggtgaatttggtacagataacgtagatagcgaagttgaaaaa
cgtctctcacatttgcgctcgggcatgcctcaccgctttacccgccagcgcaaagatggc
cgagtcattgaaatggtcggcaacccgctacctggtggcggcttcgtaacaagtttcaac
gacataacagggcatgtggaaattcagcaggctctagaagagtcgaatatagatcttgaa
gcgcgaattaaaaagcgtactgaagaagtgcattcaattaacgccgagttacgtcttgaa
attgaacgtcgttctgaagcagaaaaagagctgataagagcaagaaaagcggccgaagat
gctaacgccagtaaaacccggttcttggcgctcgccagtcacgacgttctgcagcctttg
aacgcggcaaagctttatgtcagtgcgctagaagagcaagagctacccgaatcgtcccac
gccattattcagaaacttggacacagcgttacgtcgagcgaaacactgattggtacactg
ttagatattgcacgtttagatcagggcgagatgaaaccggatattgaatctattgatatt
acggcactactttccccgctgatagacgaaatggccatgcgagccaaagaaaaaggcttg
ggctttaaagccattgtgcgtccctgctgggttagagcggacaaaacctacttgtaccga
attactcaaaatttgctatcaaatgctgtgaaatataccgaaaagggacgggttctattt
attgtaaaaccaataaaaaacaccgttcattttaaaattctcgatacgggcataggtata
tctgccgataaaaaagacagtatcttcggcgactttttccgtgcaaacgagagtaaagag
cacggtttggggctgggcttaggggtagtaaggcgcctaagccttcaactaaacagcgat
atccaagtcatgtcacaaataggtaaaggcagttgttttacgtttacgctcgagaaagcc
gaacccaaacgggtatcgagtattgtatcgaaacctcgcggcaccaccttcacgggtatg
gacgttctgtgtgtggacgatcaaaaagaaaaccttgatgccatgaaaacccttttgcaa
aagtgggggattaacgttgcccttgccaacaactgggatgatgcactaaccctgtgtaag
acaattcagccgcaaattctgttaatggattatcagcttagccacgacagcgagaaaaac
ggattagcgctgatagaggaaattaggcacaggcttaacattgtggtgccagccgctttg
ataaccgcaacccccgatgagagcttggtcacacaatgtaaagcgcagggcgtaaacttt
ttggcaaagccacttaaacccgccaaactccgtgcccttcttcaaagtatgacgcgctat
attagggaagcaaaaaacgtttag

DBGET integrated database retrieval system