KEGG   Alteromonas mediterranea U8: I634_16810Help
Entry
I634_16810        CDS       T02722                                 

Definition
(GenBank) acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
amao  Alteromonas mediterranea U8
Pathway
amao00010  Glycolysis / Gluconeogenesis
amao00620  Pyruvate metabolism
amao00630  Glyoxylate and dicarboxylate metabolism
amao00640  Propanoate metabolism
amao00680  Methane metabolism
amao01100  Metabolic pathways
amao01110  Biosynthesis of secondary metabolites
amao01120  Microbial metabolism in diverse environments
amao01130  Biosynthesis of antibiotics
amao01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:amao00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    I634_16810
   00620 Pyruvate metabolism
    I634_16810
   00630 Glyoxylate and dicarboxylate metabolism
    I634_16810
   00640 Propanoate metabolism
    I634_16810
  09102 Energy metabolism
   00680 Methane metabolism
    I634_16810
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:amao01004]
    I634_16810
Enzymes [BR:amao01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     I634_16810
Lipid biosynthesis proteins [BR:amao01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   I634_16810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: AGP95046
Position
complement(3839040..3840986)
Genome map
AA seq 648 aa AA seqDB search
MTAGKTYPVPENILQSTHLNASQYDEMYKQSIDQPEAFWGEHASILEWYQKPTKIKNTHF
GENDVSIKWFEDGELNASYNCIDRHLANNATKVAFHWEGDSPEDSQDITYQEVHYEVCKL
ANALKGMGVAKGDRVAIYMPMVPEAAYAMLACARIGAVHSVIFGGFSPNAIADRINDSSA
KVVITADEGRRAGRSIPLKANVDKALAGDACPSITHVLVHKLTGGDVDWNEKHDVWWQDA
VDGMSAQCEPEVMNAEDPLFILYTSGSTGTPKGVVHTTGGYLLYSAMTFKYAFDYKDDDV
YWCTADVGWITGHSYMVYGPMVNAASQVFFEGVPTYPDVKRIAQVVEKYKVNSLYTAPTA
IRALMAHGDAPAEGCDLSSLRLLGTVGEPINPEAWEWYHRVIGQGRCPIIDTWWQTETGG
HMILPLPGATELKPGSASRPFFGIQPALFDADGKELEGAAEGNLVIKDSWPSQARTVYGD
HQRFINTYFSAYKGVYFTGDGARCDEDGFYWITGRVDDVLNVSGHRLGTAEIESALVAHP
KVAEAAVVGFPHDIKGQGIYVYVTPNEGVEADEALTKELKAWVRQELSPIATPDMIQWSH
GLPKTRSGKIMRRILRKIAANEHEQLGDTSTLADPSVVDTLIEERLNK
NT seq 1947 nt NT seq  +upstreamnt  +downstreamnt
atgaccgccggcaaaacttatcctgtacctgagaatatccttcagtctacacatcttaat
gcgtcgcaatatgacgaaatgtacaagcaatctatagatcaacccgaagcgttttggggc
gaacatgcgtctatccttgagtggtaccaaaagccaaccaaaattaaaaacacgcatttt
ggtgaaaacgacgtgtctatcaaatggtttgaagacggtgagttaaacgccagctataac
tgtatcgaccgccatcttgctaataatgccacaaaggttgcctttcattgggaaggtgac
tctcccgaagatagtcaagatattacctaccaagaagtgcactacgaagtatgtaagtta
gcgaatgcactgaaaggcatgggcgtagcaaaaggtgaccgtgtagctatctatatgcca
atggtgccagaggcggcttacgctatgcttgcctgtgcccgaataggggctgttcactcg
gtgatctttggcggcttctcgccaaacgccattgccgatcgcattaacgacagcagtgca
aaagtcgttattacggctgatgaaggacgccgtgctggaagaagcattcccttaaaagcg
aatgtagataaagcgctggcaggcgatgcatgcccgtcgattactcacgtactggtccat
aaacttactggtggtgacgttgattggaacgaaaagcatgatgtgtggtggcaagatgcc
gtagacggcatgtctgcccagtgtgagccagaggtaatgaacgcggaagacccgctattt
attctttatacatcaggttcaacgggaacgcccaaaggcgtggtgcataccacagggggg
tacctgttgtattctgccatgacctttaaatatgcattcgactataaagacgatgatgtt
tactggtgtacggctgatgtgggttggattacaggccacagctacatggtgtacggccct
atggttaacgccgcttcgcaagtcttttttgagggggttccgacgtacccagatgttaag
cgcattgctcaagtggtagagaagtacaaagtaaatagcctttacactgcgcctacggct
attcgtgcgctaatggctcacggcgatgcgcccgctgaaggttgcgatttatcatcactg
cgtttacttggcaccgtgggtgagccgattaaccctgaagcgtgggaatggtatcaccgc
gtgattggtcaaggccgctgccccattatcgatacgtggtggcaaaccgaaaccggtggt
cacatgattttaccactacccggtgcgacggaattaaaaccaggctcagccagtcgtcct
ttctttggtattcagccggcgttgtttgatgcagatggcaaagagttagagggagcggcc
gaaggtaacttggtgattaaagacagttggccaagccaagcgcgcacggtatacggcgac
catcagcgttttatcaatacgtattttagtgcatacaaaggggtgtactttaccggtgac
ggtgcccgctgtgatgaagatggtttctattggatcactggccgcgtagatgacgtgtta
aacgtgtcaggtcaccgcctaggcaccgcagaaattgaaagtgcgctggttgctcatcct
aaagtggcggaagctgcggtagtaggttttcctcacgatattaaagggcagggcatttac
gtttacgtgacaccaaatgaaggggttgaagcagacgaagcgctaaccaaagagcttaaa
gcgtgggtacgccaagagcttagtccaatagccacgcccgatatgattcagtggtcacac
ggtttacccaaaacccgctcgggtaaaattatgcgccgcattcttagaaaaatcgcggct
aacgagcacgagcaattaggtgacacttctacattggcggatccgtcggttgttgataca
ctgatagaggaacgtctaaataagtaa

DBGET integrated database retrieval system