KEGG   Alteromonas mediterranea U8: I634_16825Help
Entry
I634_16825        CDS       T02722                                 

Definition
(GenBank) NADPH-dependent aldose reductase
Organism
amao  Alteromonas mediterranea U8
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldo_ket_red DUF2774
Motif
Other DBs
NCBI-ProteinID: AGP95049
Position
complement(3843735..3844787)
Genome map
AA seq 350 aa AA seqDB search
MKFNRLGTSDLQVSDVCLGTMTWGIQNTQQDADEQLAYALDKGVNFIDTAEMYPVPPNVD
TYGDTERVIGNWLSRNPSKRADIVLMTKIAGSGLKYIRNAGPITADAIANALTYSLERLN
TDYIDVYQLHWPNRVTPHFGKHWPDGANPTKTNREQELDGMRDILTGIKRALDEGKIRHW
GLSDDTPWGIHTFLMLCNEMDIPLPVSIQNEFSLLHAKDWPYLIEMCELENIAYLPWSPL
ATGMLSGKYQKGARPEGSRWTLAQRMGLFRDKPPAQAATAEYMQIAKKAGITPSQLALAW
CQQVPGVTSTIIGATTMPQLKENIDAFDLSLSQETLDDVHSVLRQYPMGF
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgaagtttaaccgcttaggaactagcgatttacaagtgtctgacgtgtgtttaggtaca
atgacatggggtattcaaaacactcagcaagacgcagatgagcaactagcatacgccctt
gataaaggcgttaattttatcgataccgcagaaatgtacccagtgccgcccaatgttgat
acgtacggcgatacagagcgcgtgatcgggaattggctctcgcgcaacccgtcaaagcgc
gctgatattgtactgatgactaaaattgcaggtagcggtttaaagtatattcgcaatgca
gggcctattaccgccgatgcaatcgccaatgcgttaacgtattcattagaacgcctgaat
accgattatatcgatgtttatcaacttcattggcctaatcgagtcacccctcactttggt
aagcactggcctgatggcgcgaaccctacgaagaccaatagggagcaagaacttgatggt
atgcgagatatactaaccggaattaagcgcgcccttgatgaaggaaaaataaggcattgg
ggattgtcggatgatacgccatggggaattcacacatttttgatgctatgtaatgaaatg
gatatcccacttcctgtttccattcaaaatgaatttagtctacttcacgcaaaagattgg
ccgtatctgatagaaatgtgtgaactagagaatattgcttatttgccctggtcgccttta
gcaacgggaatgttaagcggtaaatatcaaaagggggcgcgtcctgaaggaagccggtgg
acattagcacagcgaatgggactatttagagataagccgccggcgcaggctgccaccgct
gagtacatgcagattgccaaaaaggccggaattacgccgtctcaacttgcgttagcctgg
tgtcagcaggtccctggcgtcacttctactattatcggcgcaacaacgatgccccagcta
aaagagaatattgatgcgttcgacttatcgctttctcaagaaaccttagatgacgttcac
agtgtgctaaggcaatatcctatgggcttctaa

DBGET integrated database retrieval system