KEGG   Alteromonas mediterranea U8: I634_16875Help
Entry
I634_16875        CDS       T02722                                 

Definition
(GenBank) toxin secretion ABC transporter ATP-binding protein
Organism
amao  Alteromonas mediterranea U8
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_membrane
Motif
Other DBs
NCBI-ProteinID: AGP95057
Position
complement(3861741..3863459)
Genome map
AA seq 572 aa AA seqDB search
MAKPINLRKTRKTLFSLLKPEAGFFWVAIAYGVAISLMTLAVPIAVQTLINSIANIGSTR
AVVILAVVLFLTLFISGVFSALRMRVMEFYERKVYARLTADIGLKTILAPHSFFEGRQNV
SITQRYFDIMTFQKNIPSLMIDGFALVLQMLVGFTLVSFYHPALFAFNVVLLLTMYAVWK
IWGRGAKRTAIELSHAKYDSAKWLHDIAIAHEFFKSADHVEYAGRSTEGYISDYVQKHKN
HFHYTFSQVVMFLLMYAVASASLLGIGGVLVVQGELSIGQLVAAELVMSAVFFGLSRFTQ
YLKLYYELYGAAEKLGGALAMPQEELNASEHVPASSKLVFNDVELKHGNDTCQLNVVFEP
GTKYFVTTDKSWVQKQLVGLLKQYDRVKSGDILLGELSLNDYDTHELRQAVTILDRSLII
EVSIERYLKLAHPQATIADIRAALEEVEMTKTIDGLPEGLQTKVSVLGAPLQPLEFLLLK
LAAAIIAKPKLLILNQHFDAIPIELRARLLNRLTKYDFTVMYFSNIPIPECFDGVIHLHD
NATAMLSEYNNGVAPVSLDVQSDNKNANKEGE
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
atggctaaaccaataaatttacgcaaaacgcgaaaaacgcttttttcgcttctaaaaccc
gaggctggctttttctgggttgctattgcctacggtgttgcaattagtttaatgacattg
gcagtgccaattgcagtgcaaaccctaatcaacagtatcgccaacataggctcaacccgt
gctgtggtcatcctagctgttgtcttgtttcttactttatttatatcaggtgtatttagt
gcccttcgtatgcgggtgatggagttttacgagcgaaaggtttacgcgcgtttaactgcc
gacatcggccttaaaactattcttgcgccccatagcttttttgaagggcggcaaaacgtc
agcataacccagcgctatttcgacattatgacgtttcaaaagaatatcccgtctttgatg
atcgacggctttgccttggtattgcagatgctggtgggcttcactctggtatccttttac
cacccggcgttgttcgcgtttaacgtggtgcttttacttaccatgtatgcggtgtggaaa
atttggggccggggcgctaagcgcactgctatcgagttatctcacgcgaaatacgactcg
gccaagtggcttcacgatattgctattgctcacgagttctttaagtcggcagatcatgtc
gagtacgccgggcgcagtaccgaaggttacatcagtgactatgtgcaaaagcataaaaac
cattttcattacacgttctcgcaggtggtcatgttcttattaatgtatgccgtagccagt
gcttctttattgggtattggcggtgtactggtggtacaaggtgaactgtctattggtcag
ctagttgccgctgagctggttatgtcagccgtattctttggtttatctcgcttcactcaa
tacttaaagctttattacgaactttacggagcagccgaaaagctaggtggagctttagct
atgccgcaagaagagcttaatgcgtcagaacatgtacccgcatcatcaaaactggtattt
aacgatgtcgaacttaaacacggtaacgatacctgccaattaaatgtggtattcgaacct
ggcactaagtactttgtgactacagataaaagctgggttcaaaagcagcttgtaggttta
ttgaagcagtacgacagggttaagtcgggcgatattttattgggtgaattaagccttaac
gattacgacacccacgagctaaggcaagcggtgactatcttagatcgctcgctgattatt
gaagtgtcgatagagcgttacttaaagctcgctcacccacaggccaccattgccgatatt
cgcgcagcgcttgaagaagtggaaatgaccaagacaattgacggcttgcccgagggcctt
caaacgaaagtgtctgtattgggcgcgccattgcagccgcttgagttcttattacttaaa
ctggctgctgccattatcgccaaacctaaattattgatattgaatcaacactttgatgcg
atccctattgaacttcgcgcgcgccttctaaaccgcttaaccaagtacgattttacggta
atgtacttttcaaacatcccaatacccgaatgcttcgatggtgtgatacatctgcatgac
aacgccaccgctatgcttagcgagtataataatggggtagcgccagtgagtttagatgtg
caaagcgataacaagaacgcaaataaggagggtgaataa

DBGET integrated database retrieval system