KEGG   Alteromonas mediterranea U8: I634_16900Help
Entry
I634_16900        CDS       T02722                                 

Definition
(GenBank) nucleotide sugar dehydrogenase
  KO
K00012  UDPglucose 6-dehydrogenase [EC:1.1.1.22]
Organism
amao  Alteromonas mediterranea U8
Pathway
amao00040  Pentose and glucuronate interconversions
amao00053  Ascorbate and aldarate metabolism
amao00520  Amino sugar and nucleotide sugar metabolism
amao01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:amao00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    I634_16900
   00053 Ascorbate and aldarate metabolism
    I634_16900
   00520 Amino sugar and nucleotide sugar metabolism
    I634_16900
Enzymes [BR:amao01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.22  UDP-glucose 6-dehydrogenase
     I634_16900
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UDPG_MGDP_dh_N UDPG_MGDP_dh UDPG_MGDP_dh_C Semialdhyde_dh NAD_Gly3P_dh_N ApbA Pyr_redox Methyltransf_16 TrkA_N 2-Hacid_dh_C NAD_binding_7 3HCDH_N NurA Glyco_hydro_4
Motif
Other DBs
NCBI-ProteinID: AGP95062
Position
complement(3867184..3868359)
Genome map
AA seq 391 aa AA seqDB search
MSNYKIAVAGTGYVGLSNAVLLAQHNEVKAVDLVAEKVEMLNNKKSPIEDKEISEYLATK
ELNLEATLDAHLAYKDADYVIIATPTDYDPQTNYFNTGSVEAVIKTVMEINPNAVMIVKS
TVPVGFTKDGKARFGTENLIFSPEFLREGKALYDNLHPSRIIVGERSERAEVFAKLLQQG
AIKEEIEVLFTDSTEAEAIKLFANTYLAMRVAYFNELDSYAERNGLDTKQIIEGVGLDPR
IGKHYNNPSFGYGGYCLPKDTKQLLANYSEVPNNMIQAIVDANRTRKDFIADSIVSRGPK
IVGIYRLIMKTGSDNFRASAIQGIMKRIKAKGIEVVVYEPVLKEDDFFNSRVVNDLEEFK
KISDVIVANRVTGDIEDVLEKVYSRDLFNAD
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgagcaattacaaaatagcggtggcaggtactggatacgtaggcttatcaaacgccgtg
ctactagcacaacacaatgaagtgaaagcggtcgacttggtagcagaaaaagttgagatg
cttaataataaaaagtctcccattgaagacaaagagatttcagaatatcttgcgactaaa
gagcttaaccttgaagccacgttagatgcacatttagcatataaagatgcggattacgtt
attattgccacgcctactgactacgacccgcaaactaactactttaatacgggtagtgta
gaggcggttatcaaaacggtaatggaaattaaccctaatgcagtgatgattgttaaatcg
actgtgccagtagggttcactaaagacggaaaagcacgtttcggtactgaaaatctaatc
ttctctccagagttcttacgtgaaggtaaagcactttacgataaccttcaccctagccgc
attattgtgggtgaacgtagcgaacgcgctgaagtattcgctaaattgcttcagcaaggc
gcgattaaagaagaaatcgaagtgttatttactgacagcactgaggctgaagccattaag
ctattcgctaacacttacttagcgatgcgtgttgcttatttcaacgagttggatagctat
gctgaacgaaatggcttagacaccaaacaaattattgaaggtgtaggcttagaccctcgt
attggtaagcactacaataatccaagctttggttacggtggttactgcctaccaaaagat
actaaacaattgttggctaactacagtgaagtgcctaacaacatgattcaggctattgta
gatgctaaccgtacccgtaaagactttattgccgattcaattgtaagccgtggcccaaag
attgttggtatctaccgccttatcatgaagactggttctgacaacttccgcgccagtgca
attcagggcatcatgaagcgcattaaagcgaaaggtatcgaagtggtagtatacgagcca
gtacttaaagaagatgacttctttaattcacgtgtagtaaacgatttagaagagtttaag
aaaatctctgatgttatcgtcgccaaccgtgtaacgggcgatatcgaagacgtacttgaa
aaagtatatagccgcgacttgttcaacgccgattaa

DBGET integrated database retrieval system