KEGG   Alteromonas mediterranea U8: I634_16905Help
Entry
I634_16905        CDS       T02722                                 

Definition
(GenBank) glycosyl transferase
  KO
K20444  O-antigen biosynthesis protein [EC:2.4.1.-]
Organism
amao  Alteromonas mediterranea U8
Brite
KEGG Orthology (KO) [BR:amao00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:amao01005]
    I634_16905
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:amao02000]
    I634_16905
Enzymes [BR:amao01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.-  
     I634_16905
Lipopolysaccharide biosynthesis proteins [BR:amao01005]
 O-antigen
  I634_16905
Transporters [BR:amao02000]
 Other Transporters
  Others
   I634_16905
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_2 Glyco_tranf_2_3 Glyco_tranf_2_2
Motif
Other DBs
NCBI-ProteinID: AGP95063
Position
complement(3868416..3870134)
Genome map
AA seq 572 aa AA seqDB search
MKKLAMLTVKGAVGLVPRAVRNKLKSNHKLTEFYSRSLQRSGLFYGFPSEKKRMAMYSAY
LTHQNHRLQNLASIDEGARETSVVIIGIQKLSLTLASLNRVGIENERIFVVSEQDIEASV
HCFTTISDAVNSISPSCRLLFLNSGDTIAKDSFELFLRCDSSADLVYCDTDKVDVKARRV
SPHFLPDWNPDLQLSTGYVFTGVICRANLIHSNSIASSSIAGLVAELWVKQPQLSVEHIP
YTLIHRSFNKTAITNGLTDIRKVLECATHAISSYNEELVVNHVQWPIESEPLVSLIIPTK
NGKSLVKACIESILEKTVYQNYEILLIDNGSDETESLEYFAKLNKHPKVRVLSYPGEFNY
SAINNFGVQHASKKSRLIGLINNDIEVINPYWLSSMVGHALRDDVGCVGAKLLYSDGRIQ
HAGVVLGYGGGAGHAHKYFPRYHPGYMKRLIATQNYSAVTAACLLVKKSLFLDVGGLNDK
DLTVAFNDVDFCLRIKETGVRNVYCAEAELYHHESVSRGLDHAPEKAARFNRELEYLKKQ
WGKYIEHDPAYSPNLTLTRENFSIKAKEEFSS
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaactggccatgttaactgttaaaggggctgttggtttagtacctcgagcggtg
aggaacaaactgaaaagcaaccataaactcactgaattttacagccgctctttacaacgt
tcaggtctgttttatggcttcccctctgaaaaaaagcggatggctatgtacagtgcttac
cttacacatcaaaaccatcgtcttcaaaacctcgcttctatagacgaaggcgctcgcgaa
acaagcgtagttattattggaatccaaaagctatctttaacgctagcgtcgcttaaccga
gtaggcatagaaaatgaacgcatttttgtggtgagtgaacaagacattgaggcctcagta
cactgctttacaacaatttctgatgcggtgaatagcatctcgccttcatgccgtctgctg
ttcttgaatagtggagatacaatagcgaaagattcttttgaattgtttctaagatgcgac
agtagcgctgatctcgtctattgtgataccgataaagttgacgtaaaagcgcgtagagtt
tcccctcactttttacctgattggaacccagatctacaactttccactgggtatgtgttt
acgggggtcatatgtcgggctaaccttattcactcgaattcaattgcctcttcgtccatt
gcggggctagttgcagagttatgggtgaaacaaccacaattatcggtcgaacatattcct
tatacactcattcaccgttcgtttaataaaactgctattacgaatggccttacagatata
agaaaagtgctcgaatgcgcgactcacgccatttcatcttataatgaagagcttgttgtt
aatcacgttcagtggcctattgaatctgagcctttagtttctcttattatccccactaaa
aatggcaaatcgcttgttaaggcctgtatagagtcaatattagaaaaaaccgtttatcaa
aattatgaaatattactcattgataatggatctgatgaaaccgaaagcctcgagtacttt
gcgaagttaaacaagcatccaaaagttcgcgtccttagttatccgggagagtttaattat
tccgcaataaataattttggcgtacaacatgctagcaaaaagagtaggttgatagggctt
atcaacaatgatatcgaagtcatcaacccttattggcttagcagtatggtcggacacgca
ctgcgggacgatgttgggtgtgtaggtgccaaacttttgtattcagatggaagaatacag
catgccggtgtggtactagggtacggtggtggtgcaggtcatgcacataaatatttccct
cggtatcatccggggtatatgaaacgcttaatagcaacgcaaaactattcagcggtaact
gcggcctgtttattagtgaagaagtcgctgtttttagatgttggcgggttgaatgataaa
gaccttactgtcgcatttaatgacgttgatttttgtctaaggattaaagaaaccggggtg
cgcaacgtttactgcgcggaagccgaactatatcatcatgaatcggtgagtaggggatta
gatcatgcgccggaaaaagcggcaaggtttaatcgagaactagaatacttaaaaaaacag
tggggcaagtatattgaacatgaccctgcatacagtccaaaccttacacttacgcgagag
aacttttccattaaagcaaaggaagagttttctagttaa

DBGET integrated database retrieval system