KEGG   Alteromonas mediterranea U8: I634_16920Help
Entry
I634_16920        CDS       T02722                                 

Definition
(GenBank) dTDP-4-keto-6-deoxy-D-glucose-3,6-epimerase
  KO
K01790  dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
amao  Alteromonas mediterranea U8
Pathway
amao00521  Streptomycin biosynthesis
amao00523  Polyketide sugar unit biosynthesis
amao01130  Biosynthesis of antibiotics
Module
amao_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:amao00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    I634_16920
  09110 Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    I634_16920
Enzymes [BR:amao01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     I634_16920
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dTDP_sugar_isom DUF1255
Motif
Other DBs
NCBI-ProteinID: AGP95066
Position
complement(3872280..3872825)
Genome map
AA seq 181 aa AA seqDB search
MQAISTDIPDVKIIEPKVFGDERGFFLETFRTDWFKKECADVDFVQDNHSKSSQGILRGL
HYQMEQTQGKLVRVVSGEVYDVAVDMRKDSPTYGKWVGVTLSAENKRQLWVPAGFAHGFY
VTSESAEFVYKCTDYYHPESEVSVKYDDPTLNIDWPLVNGEKPSLSGKDEAGLAFVDAPT
F
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgcaagcaattagtacagacatccctgatgttaaaattatcgagccaaaagtatttggt
gacgagcgcggttttttcctagaaacgtttcgcaccgactggtttaaaaaagaatgcgcg
gatgttgatttcgttcaagataatcactctaagtctagccaaggtattcttcgtggcctt
cattatcaaatggagcaaacccagggtaaattagtgcgtgtggtaagcggtgaagtatac
gatgtagctgtagatatgcgtaaagactcacctacctatggaaagtgggtgggtgtaacc
ctgtctgctgaaaataaacgccagctttgggtgccagcgggctttgctcatggtttctat
gtaaccagcgaatcggctgagtttgtgtacaagtgcacagactactatcatccggaatct
gaggtatcggtaaaatatgacgacccaacgttgaatatcgactggccgctagtgaacggc
gagaaaccttcattatctgggaaagacgaagctggtttggcatttgtagatgcccctacg
ttttaa

DBGET integrated database retrieval system