KEGG   Alteromonas mediterranea U8: I634_16925Help
Entry
I634_16925        CDS       T02722                                 

Definition
(GenBank) glucose-1-phosphate thymidylyltransferase
  KO
K00973  glucose-1-phosphate thymidylyltransferase [EC:2.7.7.24]
Organism
amao  Alteromonas mediterranea U8
Pathway
amao00521  Streptomycin biosynthesis
amao00523  Polyketide sugar unit biosynthesis
amao00525  Acarbose and validamycin biosynthesis
amao01130  Biosynthesis of antibiotics
Module
amao_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:amao00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    I634_16925
  09110 Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    I634_16925
   00525 Acarbose and validamycin biosynthesis
    I634_16925
Enzymes [BR:amao01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.24  glucose-1-phosphate thymidylyltransferase
     I634_16925
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3
Motif
Other DBs
NCBI-ProteinID: AGP95067
Position
complement(3872852..3873730)
Genome map
AA seq 292 aa AA seqDB search
MRKGIILAGGSGTRLHPLTKVVSKQLMPVYDKPMIYYPLTTLMMSGIRDVLIITTPEEQQ
RFIDLIGDGSSLGMNIQYAVQPSPDGLAQAFLIGEDFIGNDSCSLVLGDNIYYGHDLKVS
LQNAFKQEHGATVFGYHVHDPERYGVVDFDENWNALSIEEKPAKPKSNYAVTGLYYYDNR
VVDFAKEVKPSPRGELEITDLNNLYLQDGSLKVELMGRGSAWLDTGTLDSLLDAANFVAA
IEKRQGLKVCCPEEVAFRMGYIDAEQLERLAAPLKKSGYGDYLLKVIHDRVK
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaggaataattctagcaggtgggtcgggtactcgcctacacccattaacgaaa
gtagttagtaaacagttaatgcctgtatacgacaagccgatgatttactacccactaact
acccttatgatgtcgggtataagagatgtcctcatcataaccacccctgaagaacagcag
cgctttattgatctaattggcgatggctcgtctttaggtatgaacatccaatatgcagtg
cagccatcacccgatggcttggcccaagcgtttttaattggcgaagactttattggcaac
gacagttgttcattggtactgggcgataatatttactacggccacgacctaaaagtgtct
ttgcaaaatgcattcaagcaagaacatggtgctacagtatttggctatcacgttcatgat
ccagagcgctatggtgttgtagacttcgacgaaaattggaatgcactttctattgaagaa
aagccagctaaacctaagtcgaattatgccgtgacaggcctttattactacgataaccgt
gtggtagattttgcgaaagaagttaaaccttcgccacgtggtgagcttgaaatcactgat
ttaaataatctataccttcaagatggctcacttaaagtagagctaatgggccgaggctct
gcgtggttagacacgggtacgctcgattcactactagacgctgcaaactttgtagcggct
atcgagaaacgccaaggcctaaaggtatgttgccctgaagaagttgctttccgtatggga
tatattgatgctgagcaacttgaaaggttagctgcgccacttaaaaagagcggctatggt
gattacctgctgaaagttattcacgaccgcgttaaataa

DBGET integrated database retrieval system