KEGG   Alteromonas mediterranea U8: I634_16960Help
Entry
I634_16960        CDS       T02722                                 

Definition
(GenBank) transposase
Organism
amao  Alteromonas mediterranea U8
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DDE_Tnp_IS66_C DDE_Tnp_IS66
Motif
Other DBs
NCBI-ProteinID: AGP95074
Position
complement(3883006..3883326)
Genome map
AA seq 106 aa AA seqDB search
MISFLLNDRWDYRTLTIKPFVIGRKNWLFSQTATGANASAILYSITETAKANDLNVFEYV
MDCLEQLSRPDTDIEQLLHGSLLNDRWDYRTLTHGHCPKQKENTMP
NT seq 321 nt NT seq  +upstreamnt  +downstreamnt
gtgattagttttttgctaaacgataggtgggattaccggacgcttaccattaaaccgttc
gttataggcagaaaaaactggctgttcagccagaccgcaaccggtgccaatgccagcgcc
atcctctatagcatcaccgaaacagcgaaggccaacgacctcaacgtcttcgagtatgtc
atggactgcctggagcaactcagcagaccggacaccgatatcgaacagttactccatggc
agtttgctaaacgataggtgggattaccggacgcttacgcatggtcattgccccaaacaa
aaagagaataccatgccgtag

DBGET integrated database retrieval system