KEGG   Alteromonas mediterranea U8: I634_16965Help
Entry
I634_16965        CDS       T02722                                 

Definition
(GenBank) hypothetical protein
Organism
amao  Alteromonas mediterranea U8
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AGP95075
Position
complement(3883333..3883611)
Genome map
AA seq 92 aa AA seqDB search
MFEFSIASPHKNVLWYDYRVFINTKHELEKLGCVYKKNAVNRIYLLSPPVRKSYEDVSEF
EPDANNIAIIYSHFEKVENLNGFNKVFVPKAC
NT seq 279 nt NT seq  +upstreamnt  +downstreamnt
atgtttgagttttctattgcttcaccccataaaaatgtcttgtggtacgattacagggtt
tttatcaatacaaaacatgagttagaaaagcttggttgtgtttacaaaaaaaatgccgtt
aatcgaatctacttactgagtccacctgttagaaaaagctatgaggatgttagtgagttt
gaacctgatgctaataacattgccatcatttattctcatttcgaaaaagtagagaaccta
aacgggtttaacaaagtatttgtgcctaaggcctgttga

DBGET integrated database retrieval system