KEGG   Alteromonas mediterranea U8: I634_16970Help
Entry
I634_16970        CDS       T02722                                 

Definition
(GenBank) hypothetical protein
Organism
amao  Alteromonas mediterranea U8
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sulfotransfer_2
Motif
Other DBs
NCBI-ProteinID: AGP95076
Position
complement(3883636..3884346)
Genome map
AA seq 236 aa AA seqDB search
MKIISTFNKFRPHFNSILGTSDVRWLSHHIPKTAGTSLRASFDEAFGRRQVYDLYNPTLV
KDFSNGQRLDIPKRISLIHGHFQPHPNQTEFYQNAKRIIWIRDPVARAWSVLKHLISVQK
HKKEFLLLEESFGERVHTPDDEILDFFLKKNEFKHLNRPYQNYFKNVPIEHFAFVGVTER
FDSDIKKLSELMEVNLKIKTLNAIPSKSVIKKDDFKHYLEEEYFLVRNFIDYDSPQ
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgaaaataatcagtacatttaataagtttaggccacattttaatagtattttaggaacc
tcggacgttagatggctttctcatcatattcctaaaacagcgggtacgtctctacgtgca
tcttttgacgaagccttcggtaggcgtcaagtgtatgatttatataacccaacgttagtt
aaagatttctcaaatggccaaaggttggatattcctaagagaatttctttgatacatggg
cattttcagccccatccaaaccaaacagagttttatcagaacgctaagcgcattatttgg
attagagatcctgtggccagagcttggtcagtgttaaagcacttgattagtgtgcagaaa
cacaagaaggagtttttgctactggaagaatctttcggggaaagggttcatactcctgat
gatgaaatactagacttttttttgaagaaaaacgaatttaagcatttgaatcgaccttat
caaaattattttaaaaacgtacctatcgaacattttgcattcgttggtgtgacagaaagg
tttgatagtgatatcaaaaagcttagcgagttgatggaagtcaatttaaaaataaaaacg
ctcaatgcaataccttcaaaaagtgtcattaagaaggatgacttcaagcactatttggag
gaagagtactttctggtcagaaactttatcgattatgactccccacaatga

DBGET integrated database retrieval system