KEGG   Alteromonas mediterranea U8: I634_16995Help
Entry
I634_16995        CDS       T02722                                 

Definition
(GenBank) flagellin
  KO
K02406  flagellin
Organism
amao  Alteromonas mediterranea U8
Pathway
amao02020  Two-component system
amao02040  Flagellar assembly
Brite
KEGG Orthology (KO) [BR:amao00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    I634_16995
 09140 Cellular Processes
  09142 Cell motility
   02040 Flagellar assembly
    I634_16995
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:amao02035]
    I634_16995
Bacterial motility proteins [BR:amao02035]
 Flagellar system
  Flagellar assembly proteins
   Rod,hook and filament
    I634_16995
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flagellin_N Flagellin_C
Motif
Other DBs
NCBI-ProteinID: AGP95081
Position
complement(3890018..3891367)
Genome map
AA seq 449 aa AA seqDB search
MLTVSSFTQSLSSNPVYSKTLTTAYERLSSGFRINSAADDSAGLQISNRLTSESLAKNQL
RRNLNDGISYAQIAEGGLQESADILQRMRQLAMQSQNGINSDADRRALDKEFQQLKNALN
GIAYNTEAFNRLPLLGDNDLLSDNVSSIGDTFVRGTPIQLDSGLRSVAYIPAGSTNISIN
IDSFSLDDDLQVFTTSGKHLVGTPLSDDVWDTNSVNSPSDIKSLLFLTQEGYTPTASYDS
SSLITNGTGTINGTSFTFSGDQHPGVTTETLTIDNTNEPLIISVVGNGVFDATVDWDTLG
VPGSGGNSFEAGPVDITATNALSEGTDYINLAKTPVGLSDLNMIESDVLTFENAEAALQQ
IDDALAYVSESRAFYGAKMNQMESALKLNDRMHKGLMAARSQILDTDFAEETAKSTQAQI
VEQASISVRAQAKSSDEQVLGLLNGSLAN
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgttaaccgtttcatcatttactcagtcgctatcatcaaaccctgtgtatagcaaaacg
ctgactaccgcgtatgagcggcttagttcagggtttagaataaatagtgctgcagatgac
agtgcaggtttacaaatatcaaacagattgacgtcagagtcactggcgaaaaatcagctt
cgccgtaacttaaatgacggcattagttatgcgcaaatagcggaaggcgggctgcaagaa
tctgccgatatcttgcagcgtatgcggcaattagccatgcagtctcaaaacggcataaac
tctgatgcggatagacgcgcgcttgataaagaattccagcagttaaaaaacgctcttaat
ggcatagcttataataccgaagcgtttaatcgactgcctttgttaggcgataacgatttg
ttgtctgacaacgtatcatcaataggcgatacctttgtaaggggcactcctatacagtta
gacagcggtctacgctctgtggcttatatccctgcaggatcaactaacatttctattaat
attgacagcttttctctagacgatgaccttcaggtatttaccactagcggtaaacattta
gtgggtacaccgctatcagacgatgtatgggatactaacagtgttaattcgcctagcgat
attaaaagcttgttgttcttaacccaagaagggtatacaccaacggcaagctacgacagt
agctcgttaattacgaatggcactggcacaataaacggaacatcattcacgttttcgggc
gatcagcacccaggcgtaacaacagaaaccttaaccatcgataatacaaacgaaccgctc
attatttcagtagtggggaatggcgtgtttgatgcaacggtagattgggatacgttaggc
gtacccggaagcggaggaaacagctttgaagccggcccagtcgacattaccgccactaac
gcgctaagcgaaggtacggactatattaaccttgcaaaaacgccagtcggtctttcagac
ttaaacatgatagaaagcgatgtgcttacttttgagaatgcagaggcggcattacagcaa
attgacgacgcactagcgtatgtaagcgagagccgagcattttacggcgcaaagatgaat
caaatggagtcagcgctcaaattaaacgaccgtatgcacaagggcttaatggcagcccgt
tctcaaatcctcgataccgactttgcagaagaaactgcaaaatcaacacaggcccaaata
gttgaacaagcgagtatctctgttcgcgctcaggctaagtctagcgatgagcaggttttg
gggttgttgaatggaagtctcgccaactaa

DBGET integrated database retrieval system