KEGG   Alteromonas mediterranea U8: I634_17025Help
Entry
I634_17025        CDS       T02722                                 

Definition
(GenBank) 30S ribosomal protein S11
  KO
K02948  small subunit ribosomal protein S11
Organism
amao  Alteromonas mediterranea U8
Pathway
amao03010  Ribosome
Module
amao_M00178  Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:amao00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    I634_17025
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:amao03011]
    I634_17025
Ribosome [BR:amao03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Small subunit
    I634_17025
  Bacteria
    I634_17025
  Archaea
    I634_17025
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_S11
Motif
Other DBs
NCBI-ProteinID: AGP95087
Position
complement(3894490..3894882)
Genome map
AA seq 130 aa AA seqDB search
MAKAPARSTRKRAKRQVADGMAHIHASFNNTIVTITDRSGNALAWATSGGSGFRGSRKST
PFAAQVAAERAGVAAQEYGLKNLEVFVKGPGPGRESAIRALNATGYKITNITDVTPIPHN
GCRPPKKRRV
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atggctaaagcaccagctcgtagcacgcgtaagcgcgctaaacgtcaggttgcagacgga
atggctcatatccatgcgtctttcaacaacacaattgtgactattacagaccgttcaggc
aatgcactagcatgggcgacatctggtggttctggtttccgtggttcacgtaaatctacc
ccatttgctgcacaggtagctgctgagcgtgcaggtgttgctgcacaagaatacggtctt
aagaaccttgaagtattcgttaaaggtccaggtccaggccgtgagtctgcgatccgtgcg
cttaacgctacaggttataagatcacaaacattaccgatgtgacccctattcctcacaac
ggttgtcgtccaccgaaaaaacgtcgcgtttaa

DBGET integrated database retrieval system