KEGG   Alteromonas mediterranea U8: I634_17035Help
Entry
I634_17035        CDS       T02722                                 

Gene name
rpmJ
Definition
(GenBank) 50S ribosomal protein L36
  KO
K02919  large subunit ribosomal protein L36
Organism
amao  Alteromonas mediterranea U8
Pathway
amao03010  Ribosome
Module
amao_M00178  Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:amao00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    I634_17035 (rpmJ)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:amao03011]
    I634_17035 (rpmJ)
Ribosome [BR:amao03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Large subunit
    I634_17035 (rpmJ)
  Bacteria
    I634_17035 (rpmJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L36
Motif
Other DBs
NCBI-ProteinID: AGP95089
Position
complement(3895429..3895545)
Genome map
AA seq 38 aa AA seqDB search
MKVRASVKKICRNCKVIKRNGVVRVICSSDPKHKQRQG
NT seq 117 nt NT seq  +upstreamnt  +downstreamnt
atgaaagttcgtgcatcagtaaaaaagatttgccgtaactgtaaagttatcaagcgcaac
ggtgttgtgcgtgtaatttgcagttctgacccaaagcataagcagcgtcagggctaa

DBGET integrated database retrieval system