KEGG   Alteromonas mediterranea U8: I634_17040Help
Entry
I634_17040        CDS       T02722                                 

Gene name
secY
Definition
(GenBank) preprotein translocase subunit SecY
  KO
K03076  preprotein translocase subunit SecY
Organism
amao  Alteromonas mediterranea U8
Pathway
amao02024  Quorum sensing
amao03060  Protein export
amao03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:amao00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    I634_17040 (secY)
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    I634_17040 (secY)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    I634_17040 (secY)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:amao02044]
    I634_17040 (secY)
Secretion system [BR:amao02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components [MD:M00335]
   I634_17040 (secY)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SecY DUF5336
Motif
Other DBs
NCBI-ProteinID: AGP95090
Position
complement(3895584..3896903)
Genome map
AA seq 439 aa AA seqDB search
MAKPGLDSGAKSGLSELKARLLFVLGAIVVFRLGSYVPIPGIDPAVLADLFEQQKGTIVE
MFNMFSGGALERASVLALGIMPYITASIIMQLLSVVHPPMVELKKEGEAGRRKISQYTRY
LTLVLAIFQSIGISTGLPNLINGLVINPGFGFYFTAVVSLVTGTMFLMWLGEQITERGIG
NGISILIFAGIVAGLPTAIGQTAEQARQGDINLLFLLLIGAIVIALTYLVVFVERGQRRI
VVNYAKRQQGRQVFAAQSTHLPLKVNIAGVIPPIFASSIILFPGTIAGWFGQNESTAWLQ
DVALMLSPGQPLYVMLYAAAIIFFCFFYTALVFNPRDTADNLKKSGAFIPGIRPGEQTSR
YIDKVMTRLTLAGALYITFICLVPEFMLIAWNVPFYFGGTSLLIIVVVIMDFMAQVQTHL
MSSQYESVLKKANLKGYGR
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atggctaaaccaggattggattcaggcgctaaaagcggcttgagtgagcttaaggcaaga
ttgttgttcgtacttggtgcgattgttgtattcagactaggttcttacgttcctatccct
ggcatcgatccagcggtacttgctgacttgttcgagcaacaaaaaggaaccattgtagaa
atgtttaacatgttctctggtggtgcgcttgagcgtgcatccgttctggctttgggcatt
atgccatacattactgcatccattatcatgcagttgctctcggtggttcacccaccgatg
gtggagcttaaaaaagaaggcgaagcaggccgtcgtaaaattagtcagtacacgcgttat
ctaacgcttgtattggctatcttccaatcaattggaatttcgactggtttgccaaacctg
attaatggattggtgataaaccctggcttcggattctactttacggcagtagtgagtcta
gtcacaggaactatgttccttatgtggttaggtgagcaaattaccgaacgaggtattggt
aacggtatctctatattgatttttgctggtattgttgccggtctgccaacagcgataggt
cagacagcggaacaagcaaggcagggcgacattaatttgttgttcctactgttgatcggc
gcaattgttatcgctcttacatacctagttgtatttgtagagcgcggacagcgcagaatt
gtggtaaactacgcaaaacgtcagcaaggccgtcaggtttttgctgcgcaaagcacccat
ttaccgctaaaagtcaacattgctggtgtaattccaccaatctttgcttctagcattatt
ctgttcccgggtaccatcgcaggatggttcggacagaatgaatcaacagcgtggttgcaa
gatgtagcgcttatgctatctcctggtcaaccgctgtacgtgatgttatacgcagctgcg
attatcttcttctgcttcttctacacggcgttggtattcaacccgcgtgatacagcagat
aacttgaagaagtctggcgcgttcatcccaggcatccgcccgggtgagcaaacgtcacga
tacattgacaaggtaatgactcgccttacactggctggcgcactgtacataacctttatt
tgtttagtgcctgaattcatgctaattgcttggaatgttccgttctacttcggtggtacg
tcgcttctaattatcgtagtagttatcatggactttatggcacaagtacagacacatttg
atgtcgagtcaatatgagtctgtgctgaagaaagctaaccttaaaggctacggccgataa

DBGET integrated database retrieval system