KEGG   Alteromonas mediterranea U8: I634_17090Help
Entry
I634_17090        CDS       T02722                                 

Definition
(GenBank) 50S ribosomal protein L14
  KO
K02874  large subunit ribosomal protein L14
Organism
amao  Alteromonas mediterranea U8
Pathway
amao03010  Ribosome
Module
amao_M00178  Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:amao00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    I634_17090
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:amao03011]
    I634_17090
Ribosome [BR:amao03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Large subunit
    I634_17090
  Bacteria
    I634_17090
  Archaea
    I634_17090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L14 Gp58
Motif
Other DBs
NCBI-ProteinID: AGP95100
Position
complement(3900564..3900932)
Genome map
AA seq 122 aa AA seqDB search
MIQMQTNLDVADNSGARRVQCIKVLGGSHRRYAGIGDIIKVTVKEAIPRGKVKKGDVLNA
VVVRTRKGVRRADGSTIRFDGNAAVMLNANKQPIGTRIFGPVTRELRSENFMKIISLAPE
VL
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atgatccaaatgcaaactaacctggacgttgcagacaacagcggcgctcgcagggttcag
tgtattaaggttcttggtggctcgcatcgccgttatgcaggtatcggtgacatcatcaaa
gttactgttaaggaagcaattcctcgcggtaaagttaaaaaaggtgacgtactgaacgca
gtggtggtgcgtactagaaaaggcgttcgtcgtgcagatggttctaccatccgttttgac
ggtaacgcggctgttatgcttaatgctaacaagcaaccaattggtacgcgtatctttggc
ccggttacccgtgagttgagaagtgaaaacttcatgaaaatcatctcattggccccagag
gtactataa

DBGET integrated database retrieval system