KEGG   Alteromonas mediterranea U8: I634_17095Help
Entry
I634_17095        CDS       T02722                                 

Definition
(GenBank) GAF sensor hybrid histidine kinase
Organism
amao  Alteromonas mediterranea U8
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c Response_reg HisKA PAS_3 PAS_9 PAS_4 GAF_3 GAF HATPase_c_5 PAS GAF_2
Motif
Other DBs
NCBI-ProteinID: AGP95101
Position
complement(3901154..3903262)
Genome map
AA seq 702 aa AA seqDB search
MSIIKELQTISNDHSLSLDKKLESLLRMDTEILGLETGIVSNIRGEQYSVLSVVTPENNI
QLDSLFSLTETYCADVVKSNSFIAYHNIDVSPGASHPCFEKYTLKSYLASPIYVSGAFFG
TVNFSSLDPREAPFSNLELDYLLLLASWVGNELERQQALNNLNAQKAVLTERNSLLNQVA
NLAGVGTWELNVETRAITWSGALRRMLHVHGDKILKPEDITKFIVDDTQRKIYLEQFTQM
MKSDEDFAYELEVRTDTGETRWLESRAHPVFEGGRCVKVIGATLDVTQMHLDKAELQHKT
NMAESALKARSEFLANMSHEIRTPIHGVQGMLEALLSSSLNSKQHELASIAMQSADALLG
IVNDILDFSKIDSGNISFEEAPTNLAEVIEEQVPMFSRLAKEKGLELIISTTALNSKTFI
ADKLRIGQILINLLNNAIKFTKEGKITVDTKCTRYGKGRYRVKLIVTDSGIGISEQQQKI
IFSPFMQAENSMQRRYGGTGLGLTIVKQIVEHYGGKIEVSSNIGIGARFTVTLTLDDANA
GAIAEKACGHDYSYTPTRQELSTLKALVVEDNEINQLVIKEQLREVGLPSEVAVNGVEAV
DKVKHSLAEKTPYAMIFMDCHMPVMGGLEATQKIRALGEQTKDVPIIALTANVLTGDKEK
CLKSGMNDFISKPVGVSRLKECVFRHLSKQLQGGTTVLKDPA
NT seq 2109 nt NT seq  +upstreamnt  +downstreamnt
atgagtatcataaaagaactacaaacaatatctaatgaccattcattgtcgttagataaa
aaactcgagagcttgctgcgcatggacacggaaattctcgggttagaaacagggattgta
agtaatatacgcggcgaacaatacagcgtgcttagcgtggtaacaccagaaaacaacatt
cagctagattctcttttcagcttaactgaaacctactgtgctgatgttgtaaaatcgaat
tcattcattgcttatcataatattgatgtctcgccgggtgcttcccacccttgtttcgaa
aaatacacgcttaaaagttatttggcgtcgcctatttatgtttctggtgcgtttttcggc
acggttaacttctcttcgcttgacccaagggaagcacctttttccaatttagagctagac
tatttgctgttgcttgcatcatgggttggaaacgaacttgaaaggcagcaggctctcaat
aatcttaatgcacaaaaagcggtgctgacagagcgaaactcattactcaatcaagtagcg
aacctagcgggcgttggcacgtgggaacttaatgtagaaacacgggcgataacctggtct
ggcgcgctaagacgtatgctgcacgttcatggtgataaaattctgaagcccgaagatatc
accaaattcattgtagacgatacacagcgcaagatttacttagagcaattcacacaaatg
atgaagtctgacgaagactttgcgtacgaattagaggtgcgcacagacactggcgaaacc
cgctggttagagagtcgagctcatccggtatttgaaggggggcgctgcgttaaagtaata
ggtgccacccttgatgtcacgcaaatgcatctagataaagcagagttgcagcacaaaacc
aatatggcggaaagcgccttaaaggctcgtagtgaatttttagctaatatgagccatgaa
ataagaacgcccattcacggtgtgcaggggatgctggaagccttgttgagctcatcgttg
aactctaagcaacacgagcttgcgtctattgccatgcaaagcgctgatgcgcttctaggt
attgttaacgacatattggacttctctaaaatagattcaggaaatatttcatttgaagaa
gcacctactaatttagcggaggtgattgaagagcaggttcctatgttttcgcgattggcg
aaagaaaaaggccttgaactcattatcagtactactgcgctcaatagtaaaacctttatt
gcagacaaactgcgtataggtcagatccttatcaacttgctcaataatgcaataaagttt
accaaggaaggaaaaatcaccgtcgataccaaatgcacccgttatggaaaaggtcgatac
cgagttaagttaattgtgacagattcaggcattggcattagcgagcagcagcaaaaaatt
atcttttccccctttatgcaagctgaaaactctatgcaaagacgctacggcggtacaggc
ttggggcttactatcgttaagcagattgttgagcattacggcggaaaaatagaggtgtcg
agtaatattggcattggtgcgcggtttacagtgacattaacgcttgatgacgcgaacgca
ggtgctattgctgaaaaagcatgtgggcatgattactcgtatacgcctacacgacaagaa
ttaagcacgttaaaagccctagttgtggaagataacgaaatcaatcagctcgtgattaaa
gagcagcttagggaagtggggctgcccagtgaggtcgcagttaatggtgtagaggccgtg
gataaagtaaaacattcactggccgagaaaacgccctacgcaatgatttttatggactgc
catatgccggtgatgggcgggctagaagcgacacaaaaaattcgtgccttgggcgaacaa
actaaagacgtgccgataattgctttaaccgcaaatgtattaaccggcgataaagaaaaa
tgcttgaaaagtggtatgaatgacttcatatctaagcctgttggtgtaagtcggttgaaa
gaatgcgttttcaggcatttgagtaagcaattacaaggtggtacaaccgtattaaaagat
cctgcttga

DBGET integrated database retrieval system