KEGG   Alteromonas mediterranea U8: I634_17100Help
Entry
I634_17100        CDS       T02722                                 

Definition
(GenBank) hypothetical protein
Organism
amao  Alteromonas mediterranea U8
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF4397 AlgF DUF4767
Motif
Other DBs
NCBI-ProteinID: AGP95102
Position
complement(3903394..3904788)
Genome map
AA seq 464 aa AA seqDB search
MQLTSQSLLSGTGFRAVAIGLVALLGLTACGGSDSSSSDYSYAYIQFYNASPNGANVEMR
EVDGDSFGSAQFGDTTSMFSMDDGELELEFIRTDSDDQEVYIDEITVDLEVGHKTIVVMS
GDFNAPTFNVYSYERETMEDHFRLFALSVAVDDSSYDFYMSESGDPFEAANFLGTVTTGD
MTELNYWDADDDSDYFDEGEYTIYLTELGSDEVVFESQTLDFVYETEYVMSLRDVSGAIQ
EGLVVDTILNSSTVTALTDVEADSQYRIYNSTNLDAELSVTFGGNTDEEDVSFTLAAGEL
SEFSAIRYGDYRVTVTDPSGAVTALSNKLITLNQGESKAVLIYNTNNVLGAATFVESGLP
QAYDKTVNFINLVSDFDDVDFYLVRNDETIDTAEYDVQNLEFAESTSEVLPSDYYEVIAV
YEDDNEEQVLLDRTALFGFTEEENYIVTVEPADTPTGYEINVLY
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgcaattgacctctcaatctttgcttagtgggactgggttccgcgcagtagcaatagga
cttgtagcactgcttgggctcaccgcatgtggtggctctgacagcagcagttcagattac
tcctacgcttacattcagttttacaatgcctcgccaaatggtgctaacgtagaaatgcgt
gaagttgatggcgatagcttcggctcggcccagtttggtgatacaacgtctatgttttca
atggatgatggtgagctagaactagaattcatacgcaccgactctgatgatcaagaagtg
tatattgatgagattaccgtagacctcgaagtaggccacaaaaccattgtggtgatgagc
ggtgattttaatgcccctactttcaacgtttactcgtatgagcgcgaaacaatggaagat
cacttccgactatttgcgctttcagttgcggtggatgactcatcctatgatttttatatg
agtgagtcgggcgacccgtttgaagcagccaacttcttaggcacagtaacaacaggcgat
atgaccgagttaaactactgggatgcagacgatgacagcgactatttcgatgaaggcgag
tacaccatttatcttacagagctaggtagcgacgaggttgtatttgaatcgcaaacccta
gactttgtatacgaaaccgaatacgtaatgagccttcgcgatgtaagtggagcaattcaa
gaagggttagtggtagacactattcttaactcttctaccgttactgcacttacagatgtt
gaggccgattcgcagtatcgtatttataactcaaccaacctagatgctgagcttagcgtt
acctttggcggcaataccgatgaagaagatgtaagctttacccttgccgcaggcgagtta
tcggagttcagcgctattcgctatggtgactaccgcgtaacagttactgatccatcaggc
gcggttactgcgcttagcaataaacttatcacccttaatcaaggcgaaagtaaagcggtg
ctaatttacaacactaacaatgtattaggggcggcaaccttcgtggaaagtggcttacct
caggcgtacgataaaaccgtaaactttatcaaccttgtgagcgattttgatgacgtcgat
ttttatttagtaagaaacgacgaaaccatagataccgctgaatacgatgtgcaaaacctc
gagttcgccgagagcacaagtgaagtgcttccctctgactattatgaagtgattgcggtt
tacgaagacgataatgaagagcaagtgttacttgatagaacagcactgttcggttttacc
gaagaagagaactacatcgtaaccgtagagccagcagatacgcctacgggatatgaaatt
aacgtgctttattaa

DBGET integrated database retrieval system