KEGG   Alteromonas mediterranea U8: I634_17140Help
Entry
I634_17140        CDS       T02722                                 

Definition
(GenBank) phosphodiesterase/alkaline phosphatase D
  KO
K01113  alkaline phosphatase D [EC:3.1.3.1]
Organism
amao  Alteromonas mediterranea U8
Pathway
amao00790  Folate biosynthesis
amao01100  Metabolic pathways
amao02020  Two-component system
Module
amao_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:amao00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    I634_17140
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    I634_17140
Enzymes [BR:amao01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     I634_17140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PhoD PhoD_N Pur_ac_phosph_N
Motif
Other DBs
NCBI-ProteinID: AGP95108
Position
3912873..3914567
Genome map
AA seq 564 aa AA seqDB search
MDRRTFIRLSSFAGASVAVSTGLAGCTVSTSANSQPQTKSEFTHGVASGDPLKDAVIIWT
RAVPTSSSALVKADILWEMASDAAFTDVVSSGVVEAKATHDFTVKVDVSGLQPASKYFYR
FKSANNVSPVGETRTLPEADVSKVTFGIFSCSNYPAGFFTPYMEAAKDDNMDYVLHLGDY
IYEYDGKGYATEHAKEIGRTYAPDNDTELYTLTDYRNRYALYRTDEGLLALHQNKPFIVV
WDDHEITNDTYKDGAENHQADEGDFYERRAAAVQAYYEWLPIRPPFGTERLEIYRQFTFG
NLLDLYMLDTRVLARDKQLEYANYRDAETKAFDQAGFMKDISNPNRGLLGETQRNWLHTS
MKQSQAKWQVLGQQLLIGRMLFPVSIFNGVERKEIPAHVHRLANIKRKQKQGAALSEQEL
ALINTVMPYNLDAWDGYPIEREHVLMQLKSIGKPVIALAGDTHNAWHNKLTLKDGTEVGV
ELATPGVTSPGMEHYLSMDDEMAETLADDLPLLIDDLQYCNLHQRGFMTLTVSEDEAKAT
WHYVDAILTKAGKVVNTHSFEIKA
NT seq 1695 nt NT seq  +upstreamnt  +downstreamnt
atggatagaagaacgtttattaggctgtcgtcattcgcgggtgcgagcgtggcagtatct
actgggctagcggggtgtacagttagcacgtcagcaaacagtcagcctcaaactaaatcg
gaatttacccatggcgtggccagtggcgacccgttaaaagatgcagtgatcatttggact
cgcgcggttcctacatcaagctcggctttagttaaagccgatattttgtgggaaatggca
agcgatgcagcatttaccgacgtggtaagtagcggagtcgttgaggctaaagcgacacat
gactttaccgtaaaagtagatgtgtcaggtcttcagcctgcaagcaaatacttttatcgc
ttcaaaagtgcgaataatgtgagccctgttggcgaaactcgtacattgccggaagcagac
gtttctaaggtcacattcggcatattttcttgctcgaactaccctgccggctttttcacg
ccttatatggaagccgccaaagatgacaacatggattatgtgctgcatttaggcgactac
atatatgagtacgatggaaagggttacgccaccgaacatgccaaagagattggccgaacc
tatgcgccagataacgataccgagctttatacgctaaccgactaccgaaaccgctacgcg
ttgtatcgcaccgacgaaggcttgctggctttacatcaaaataagccgtttatcgttgtg
tgggatgaccatgaaattactaacgacacctataaagacggtgctgaaaatcaccaagcg
gatgaaggcgatttttatgaacgtcgcgctgcggcagtgcaagcctattatgagtggctg
cctattcgcccgccatttggcactgagcgtttagaaatctaccgtcagtttacctttggc
aacctgcttgatttatacatgcttgatacccgcgttttagcccgggataagcagcttgaa
tacgccaactatcgcgacgctgaaactaaagcttttgaccaagcaggctttatgaaagat
atcagtaatcctaatcgcggtcttttaggtgaaacccagcgcaattggctacatacctct
atgaagcaaagccaggctaaatggcaagtgctggggcaacagctattaattggccgcatg
cttttccctgtatcgatatttaacggcgttgagcgtaaagaaatacctgctcatgtacat
aggcttgcgaatatcaaacgcaaacaaaagcaaggtgctgcactcagtgagcaagagctt
gcgcttatcaatacggtaatgccctacaacttagacgcatgggatggctatcctattgag
cgagagcacgtgcttatgcagctaaaatccatcggcaagccagttattgcccttgcaggc
gatactcataatgcttggcacaacaaactaacccttaaagacggaacggaagtgggtgtt
gaacttgccacccctggggtgacgtcacccggcatggaacattatttaagtatggatgat
gaaatggcagaaacacttgctgatgaccttccccttcttattgatgatttacagtattgt
aatcttcaccagcgcggctttatgacattgaccgttagcgaggatgaagctaaagcgacc
tggcactatgtggatgcaattttgaccaaggctggaaaggtggttaacacgcatagcttt
gagattaaggcatag

DBGET integrated database retrieval system