KEGG   Alteromonas mediterranea U8: I634_17145Help
Entry
I634_17145        CDS       T02722                                 

Definition
(GenBank) RelE/StbE family addiction module toxin
Organism
amao  Alteromonas mediterranea U8
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ParE_toxin
Motif
Other DBs
NCBI-ProteinID: AGP95109
Position
complement(3914693..3914989)
Genome map
AA seq 98 aa AA seqDB search
MQLKWTDLAGTDLEKIEAHIAQKNSPSVAIDVVMNIIDSSHLVLSEHPRAGRHGRLKNTR
ELVINGLPFIVIYRENIITNCIEILRVLHDAQQWPCAD
NT seq 297 nt NT seq  +upstreamnt  +downstreamnt
gtgcagctcaaatggactgatcttgcaggtaccgatttagagaaaattgaagctcatatt
gctcaaaaaaatagcccctctgtagctattgacgttgtcatgaatattattgatagttcg
cacctagtcttatcggaacatcctagagcgggccgtcatggccgattgaagaatacgcgt
gaacttgtgattaatggcctgccgtttatcgttatatatcgagaaaacatcattacaaat
tgcatcgaaatactacgtgttcttcatgatgctcagcaatggccctgcgcagattaa

DBGET integrated database retrieval system