KEGG   Alteromonas mediterranea U8: I634_17170Help
Entry
I634_17170        CDS       T02722                                 

Definition
(GenBank) sodium-type flagellar motor component
  KO
K21217  sodium-type polar flagellar protein MotX
Organism
amao  Alteromonas mediterranea U8
Pathway
amao02040  Flagellar assembly
Brite
KEGG Orthology (KO) [BR:amao00001]
 09140 Cellular Processes
  09142 Cell motility
   02040 Flagellar assembly
    I634_17170
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:amao02000]
    I634_17170
   02035 Bacterial motility proteins [BR:amao02035]
    I634_17170
Transporters [BR:amao02000]
 Other Transporters
  Pores ion channels [TC:1]
   I634_17170
Bacterial motility proteins [BR:amao02035]
 Flagellar system
  Flagellar assembly proteins
   Motor/switch
    I634_17170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sel1 DUF4441
Motif
Other DBs
NCBI-ProteinID: AGP95114
Position
complement(3919239..3919883)
Genome map
AA seq 214 aa AA seqDB search
MKRILSTALFICVSVTGFSAHALEGETVEELRAVQLYSQDALIDMINANTHLDKVVADRC
QLVQDIEARADVLKIPAYQFLWGDMLAWGVCVDAAPSRGIGYMEDAANQGLPAALEQLGR
YYAKGTLVQQDKSRAVVYLREAAALKNLKAQIRLVELFLEGYGSPYDYEDAYHWLYNSVT
NDKKQHQQISSYLARLEKLMHPKAVRQAKRPMDS
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtattctatctaccgctttatttatctgtgtttcggtaacggggttctctgct
cacgctcttgagggggaaaccgtagaagagctgcgtgcagttcagctatacagccaagac
gcgttaattgacatgattaacgctaatacgcatctagacaaggtggtggctgacaggtgc
cagctagtacaagatattgaagcgcgagcagacgtacttaaaattccggcgtaccaattt
ttatggggcgacatgttggcttggggtgtgtgtgttgatgcggcgccgtcgcgaggcatt
ggttatatggaagatgctgcgaaccaaggtttgcccgccgcccttgaacaactggggcgt
tattacgcaaaaggcacgttggtacaacaagataagtctcgcgccgtggtgtatttacgc
gaagccgctgcacttaaaaacctaaaagcgcaaattcgattggttgagttgtttttagaa
ggttacggtagcccctacgattatgaagatgcgtatcactggctttataactcggtcaca
aacgataaaaaacagcatcaacaaatttcatcttatctagcgcgtttagaaaagctaatg
cacccgaaggcggtgcgtcaagctaagcgcccaatggatagttag

DBGET integrated database retrieval system