KEGG   Alteromonas mediterranea U8: I634_17190Help
Entry
I634_17190        CDS       T02722                                 

Definition
(GenBank) PilT-like protein
Organism
amao  Alteromonas mediterranea U8
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PIN PIN_12 PIN_3 DUF4376 UBD
Motif
Other DBs
NCBI-ProteinID: AGP95118
Position
complement(3922827..3923267)
Genome map
AA seq 146 aa AA seqDB search
MIAIDTNVLLRYLLQDDEKQAIQASQLILGSEKVLITDVVLIETVWTLKGRRYNLNKDKV
IQVIHALFAEPNLVFEDSLAVWAALKDFTNAKPIKAGGKTKQADFPDALVINKAKRHAQR
NKLNLTSVFTFDKAAQEIEGMIEPHC
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
atgatagcgatagacacaaatgtcttgctgcgttacttgctacaagatgacgagaagcaa
gccatacaagcaagccaattaattttgggctctgaaaaagtcttgattacagatgtagta
ctaattgaaaccgtatggaccttaaaaggaaggcgttataaccttaataaagataaagtt
atacaggttatccatgcgttatttgctgagccaaatcttgtgtttgaggacagtctggca
gtgtgggctgcattaaaagactttactaatgcgaaaccgatcaaggcgggtgggaaaacg
aaacaagcagacttccctgatgcgcttgttatcaataaagcaaagcgtcacgcgcagcga
aataagctcaaccttactagtgtatttacctttgacaaagcggctcaggaaattgaagga
atgattgaacctcattgctga

DBGET integrated database retrieval system