KEGG   Alteromonas mediterranea U8: I634_17200Help
Entry
I634_17200        CDS       T02722                                 

Definition
(GenBank) aminopeptidase
Organism
amao  Alteromonas mediterranea U8
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M28 Peptidase_M20 fn3
Motif
Other DBs
NCBI-ProteinID: AGP95120
Position
3923668..3925074
Genome map
AA seq 468 aa AA seqDB search
MIKNLSPQSRLRTKATSLLASTVLLSSAVSFTVHAQTEQQQALYDIAKNVSAENIEKDIT
TLVNFGTRHTLSETESDTRGIGAARRWIKSEFDKISAACGGCLEVYYQSEVISGEKRIPD
PVEVVSVIAIQRGTTDADRYVIMSGDIDSRVSDVMDFTSDSPGANDNASGVAGTLEAARV
LSKHKFNGSIVYAALAGEEQGLFGGRIMAKQAKEDGWRIKAVLNNDMIGNIEGVNGVINN
TTARIFAEGTRVTETEKEARMRRFTGGEVDSPSRNLARYIDKIADKYIENLDTMVIYRLD
RFGRGGHHRPFNDLGYPGIRIMETNENYTRQHQDLRVEDGIAYGDTLDGVNFDYAAKLTG
LNAVSLAAMAWAPNPPANVEIAGAVQPSTTLKWDALDTEQNPQLKGYKIYWRHTDAPQWE
YSKYVGNVTEATLENVVIDNYFFGVASVNKDGVESVVVYPGPAGSFGE
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atgataaaaaacctatccccacagtctagactaagaactaaagccacaagtcttctggca
tctaccgtattgttaagtagcgctgtttctttcacagttcacgcccaaaccgaacagcag
caagcactttacgatatagccaaaaacgtttctgccgaaaacatcgaaaaagacattact
acgctggtcaactttggcactcgtcacaccctttctgaaaccgaatctgacacccgtggc
ataggcgcggcacggcgctggataaaatctgaatttgataaaatttccgccgcgtgcggg
ggttgcttagaggtgtattatcagtcagaggtaatcagcggtgaaaagcgtattcccgac
cctgttgaagtggtaagcgtcattgctattcagcgcggtacgaccgacgcagatcgctat
gtaatcatgtctggcgatatcgactcgcgggtgtctgatgtgatggatttcacgtctgat
tcaccgggtgcaaatgacaacgcttctggtgttgcgggtacccttgaagccgcgcgcgtt
ttatcgaaacacaagtttaacggcagcattgtttatgctgcgctagccggtgaagaacaa
ggtttatttggcgggcgcatcatggcgaagcaagccaaagaagacggctggcgaattaaa
gccgtgctaaataacgacatgattggcaatatcgaaggggtaaacggtgtaattaataac
accactgcccgtatttttgctgaaggtactcgcgtaactgaaacagaaaaagaagcgcgc
atgcgtcgcttcacgggcggcgaagttgactcgcctagccgtaaccttgcccgctacatt
gataaaattgccgataagtatattgagaacttagataccatggtgatttatcgcttagac
cgatttggccgtggcggccaccatcgcccgtttaacgatttgggttatccgggtattcgt
attatggaaaccaacgaaaactatacccgtcagcatcaggacctgcgcgtagaagacggt
atagcctacggcgacacccttgacggcgtaaacttcgattatgcagccaaactcacagga
cttaatgcggtatcgcttgcggccatggcatgggctccaaacccacccgctaatgtggaa
attgctggcgctgtgcagccttctactacccttaaatgggatgcgttagataccgaacaa
aacccgcagttaaaagggtataaaatatactggcgtcatactgatgcacctcagtgggaa
tacagtaaatatgtgggtaacgtaaccgaagcgacgcttgagaacgtggttatagacaac
tacttctttggtgttgccagcgtcaacaaagatggcgttgaaagcgtggtagtgtatccg
ggcccagccggaagttttggtgaataa

DBGET integrated database retrieval system