KEGG   Alteromonas mediterranea U8: I634_17210Help
Entry
I634_17210        CDS       T02722                                 

Definition
(GenBank) Multi-sensor Signal Transduction Histidine Kinase
Organism
amao  Alteromonas mediterranea U8
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c PHY Response_reg GAF HisKA PAS_2 HATPase_c_3 HATPase_c_5 HATPase_c_2
Motif
Other DBs
NCBI-ProteinID: AGP95122
Position
complement(3926284..3929010)
Genome map
AA seq 908 aa AA seqDB search
MHQNHISQSSLQNCEDEAIHLIESVQSFGYVIAINPDTKKVQVFSENIKDLFKVEIVAGE
TLVTELIDIPSPDAPTFKTIHNALKGESVRHAYQWKFAKNALWLDNWEKEGSGVAFDSNG
LLVIELEPTPQLSYEAAQQWVPMDVDIRALLPNVDDKESIGDVADAIAKVFKQYIGFDSV
MVYQFDDAYCGEVIGEACESISRSFKGLKFPASDIPKQARELYLKNRVRCVFDVEEQPTP
LQPSILEAERPPLDLSMSMVRSVSPVHIEYLKNMGIRSSFSVSLVFEGKLWGLLACHNSE
PKYIDQKKRLVCESLGHLYAWQMHTKALHTRKEQFQMRQRKLNNIVHQLTSYSNPLEAIS
QKETALLDVADACGMAVITPTGNYYVGKTPSEKTLTQLLNKYSIIDSEQSLAVNRLANEV
SDGCALNGIRGMYISCVSAKLGYFTVWFREQRDKTIRWAGKEAAKKDVGKSLTPRNSFDM
YLQSVADESVEWSEDDKLIIEGFDHLFIPYALSLKASLDKQISKLEELDKAKDQFLASIS
HELRSPLNSIVGWTDLALMDVSNVDRMTDALGVIKRAASTQAALINDILDLSRIISGTMK
LSTHSLNIASSISEVAKSFEAGFASKNIQLSISCEDEHTQILGDNLRIKQVINNLLSNAL
KFTSKGGTVHVRGRREHSNYTLRVKDNGKGMTQEQVAHVFERFYQGKDSHNKHGLGLGLS
IVKSLVEMHGGEIQVHSDGPNTGTSFNITLPIAPLSLHDDIVETKNTEISDLTESLRLNG
LRILVAEDEQDARDFIKLFLESNGARVNVVKNGLLAWKELNDIPEAFDLLLSDIGMPELD
GLGLVLKMRASQNPEIAKLNAVALTAYAYTSDRVKALKAGFSNYVSKPVDGEELLTILEM
YMPETSNL
NT seq 2727 nt NT seq  +upstreamnt  +downstreamnt
atgcatcaaaatcacatttctcagtcttcacttcaaaactgcgaagacgaagctattcat
cttatcgaaagcgttcaaagtttcggttacgtaatcgcgataaatcccgataccaaaaaa
gtacaagtattcagtgagaacataaaagatttattcaaagtagagattgttgcaggtgaa
acgcttgttaccgaactcattgatattccttctccggatgcgcccacgtttaaaactatt
cacaatgcgttaaaaggcgaaagtgttcgccatgcttatcagtggaagtttgcaaaaaat
gcattgtggcttgataactgggaaaaagagggcagcggtgtagccttcgactctaacggg
ctattagtgatagagctagagccaacaccacagctaagttatgaggccgcgcagcagtgg
gtgccgatggatgttgacattcgcgcgctactacctaacgtcgacgataaagagtcgatt
ggcgatgttgcagatgcaatagcgaaggtatttaaacagtatatcggcttcgactcggtg
atggtttatcaatttgatgatgcatattgcggggaggtcataggtgaagcctgtgagtca
atttctcgttcatttaaggggttaaagtttcctgcctctgacattcctaaacaagcgcgc
gaactctatctgaaaaaccgggtgcgatgtgtatttgatgtcgaggagcagcctacacca
ttgcaaccctcaatactcgaagccgagcgcccgccattagatttgtctatgtccatggtg
aggtctgtctctcctgttcatatcgaatacttaaaaaatatgggcatacgctcttcattt
tctgtgtcgttagtatttgagggtaaactatggggcttgctagcatgtcacaacagtgag
cctaagtacatcgatcaaaagaaacgcttagtgtgtgagtcccttggacacctttatgct
tggcaaatgcacaccaaagcacttcacactagaaaagagcagttccagatgcgccagcga
aagctgaacaatatcgtgcatcaacttacatcttactctaatccgcttgaggctatttct
caaaaagaaaccgctttactcgacgtggctgatgcctgtggtatggcggtaattacgcca
acgggtaattactatgtgggtaaaaccccgtcagagaaaactcttacgcagctactcaat
aaatactcaattatcgactctgagcagtcgttagcagtaaatcgtttagccaatgaagtg
tcggatggttgtgctttaaatggtatacggggtatgtatatctcctgcgtgtcggctaag
cttgggtacttcacagtgtggttccgtgaacagcgcgataaaacaattcgttgggccggt
aaagaagcggcgaaaaaagacgttggaaagtcgcttacaccacgcaactcttttgacatg
tatttgcagagtgtggctgatgagtcagtcgaatggagcgaagatgacaagctaattata
gaagggtttgatcatctatttattccttatgcgctaagcttgaaagcgtcattggacaaa
cagataagtaagctagaagagctagataaagccaaagatcagtttctggcgagtatatct
cacgagctgcgctccccgcttaattctattgtaggttggacagacttagcgctaatggat
gtatcaaacgtcgatagaatgactgatgcattaggggtgattaagcgtgctgcttctaca
caagctgcgcttatcaatgacattctcgacttatcacgcattatttcaggcacgatgaaa
ctgagcacccattctttgaatatcgcttcttctatctcagaggtagcgaaatcgtttgaa
gcggggtttgccagtaagaatattcagctatctattagctgtgaagatgagcatactcag
attttaggcgacaacttacgtattaagcaggttattaacaacctattgagcaacgcgctt
aaatttacttccaaaggcggtacggtacacgtacgtggtaggagggagcattccaattat
actttgcgtgtaaaagataatgggaaaggaatgactcaggagcaggtagcccatgttttt
gagcgcttttaccaaggcaaagactcgcataacaagcacggcttggggctaggtttatca
attgtcaaaagcttggtggagatgcacggcggcgaaattcaagtccacagtgatggaccc
aatacaggcaccagtttcaacattacgctacctatcgctccgttaagcttgcacgatgat
atcgttgaaaccaaaaatactgaaattagcgatttgactgagtcactgcgtttaaatggc
cttcgaattttggttgccgaagacgaacaggacgcgcgcgacttcataaaactattttta
gaatctaatggcgctcgagtaaacgtggtgaaaaacgggctgctggcgtggaaagagctg
aacgacatacctgaagccttcgacttattgctttctgatatcggtatgcctgaattggac
ggcttggggttggtattgaaaatgcgcgctagccaaaatcctgaaattgccaagctaaat
gctgtagcgctaaccgcctatgcatatacatcagacagagttaaagcgcttaaagcaggc
tttagcaactatgtttctaagccagtggacggggaagagctactgactattttagaaatg
tatatgcccgaaacttccaatttgtga

DBGET integrated database retrieval system