KEGG   Alteromonas macleodii Balearic Sea AD45: AMBAS45_00285Help
Entry
AMBAS45_00285     CDS       T02253                                 

Definition
(GenBank) 3-deoxy-D-manno-octulosonic-acid kinase
  KO
K11211  3-deoxy-D-manno-octulosonic acid kinase [EC:2.7.1.166]
Organism
amb  Alteromonas macleodii Balearic Sea AD45
Pathway
amb00540  Lipopolysaccharide biosynthesis
Brite
KEGG Orthology (KO) [BR:amb00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    AMBAS45_00285
Enzymes [BR:amb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.166  3-deoxy-D-manno-octulosonic acid kinase
     AMBAS45_00285
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Kdo Pkinase RIO1 APH Pkinase_Tyr hemP Choline_kinase DUF3630
Motif
Other DBs
NCBI-ProteinID: AFT93547
UniProt: K0E5V8
Position
complement(65854..66585)
Genome map
AA seq 243 aa AA seqDB search
MGDMATIRRDIGAGHHFIFDDTLVSHPNAEMFTPDFWQLQDKITGQAKGRGTTIFIEHEG
QRWVLRHFKRGGLVGKVLSDQYLFIGVERSRPFEEFRLLEYMRAQGLLVPVPVAARIHRR
GLIYRGDLITLSIPNSKDLHHALCDKPLDKDEWYEVGRALAAMHNCQVYHHDANVRNIMI
DSDKQIWLIDFDRCEQRQGNSWKQGNLDRLLRSLHKEKAKNPVFHWQESDWSACMNGYRE
AVK
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
gtgggcgacatggcgacaatacgacgagacataggtgctgggcaccactttattttcgac
gacactttagtcagtcaccccaatgcggagatgtttacccccgacttttggcagcttcaa
gacaaaataacaggtcaagccaagggacgtggtacaaccattttcattgagcatgagggt
cagcgctgggttttacgtcatttcaaacgtggtggcttggtgggcaaagtgctgagcgat
caatatctgtttattggtgttgagcgatctcgcccgtttgaagagttcaggctgctcgaa
tatatgcgagcacaaggtcttcttgtgcctgttcctgttgcggcgcgtatacaccgccga
ggcctgatttaccgcggcgatttaattactttaagtattccaaatagcaaagatttacac
cacgcactgtgcgataaaccactggataaagatgagtggtatgaggttggccgagcgcta
gcagctatgcacaattgtcaggtgtaccatcatgatgccaacgttcgaaacatcatgatt
gatagcgataagcaaatttggcttattgatttcgatcgctgcgagcagcgtcaaggtaac
agctggaaacaaggtaatttagaccgtctgctgcgctctttacataaagagaaagcaaag
aaccctgtctttcactggcaagagagcgactggtcagcgtgtatgaatggttaccgcgag
gcagtgaagtaa

DBGET integrated database retrieval system