KEGG   Alteromonas macleodii Balearic Sea AD45: AMBAS45_04610Help
Entry
AMBAS45_04610     CDS       T02253                                 

Definition
(GenBank) putative glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
amb  Alteromonas macleodii Balearic Sea AD45
Pathway
amb00040  Pentose and glucuronate interconversions
amb00052  Galactose metabolism
amb00500  Starch and sucrose metabolism
amb00520  Amino sugar and nucleotide sugar metabolism
amb01100  Metabolic pathways
amb01130  Biosynthesis of antibiotics
Module
amb_M00362  Nucleotide sugar biosynthesis, prokaryotes
amb_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:amb00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    AMBAS45_04610
   00052 Galactose metabolism
    AMBAS45_04610
   00500 Starch and sucrose metabolism
    AMBAS45_04610
   00520 Amino sugar and nucleotide sugar metabolism
    AMBAS45_04610
Enzymes [BR:amb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     AMBAS45_04610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD AstB
Motif
Other DBs
NCBI-ProteinID: AFT94400
UniProt: K0EFU1
Position
1076664..1077557
Genome map
AA seq 297 aa AA seqDB search
MSQVKKAVIPVAGLGTRMLPATKAIPKEMLPVVDKPLIQYVVSECVAAGLKEIILVTHAS
KNSIENHFDTSFELEATLEKRVKRQLLEEVQSICPKDVTIMHIRQGVANGLGHAVLCARP
LIGDAPFAVVLPDVIIDDAASNPKKDNLADMVAKFNTSRVSQVMVEQVPDEDISKFGIAD
LDGAAIAPGESAKIHKMVEKPPRDEAPSDLAVVGRYVLSEKIWDLLEFTPPGAGGEVQLT
DAIDALMKLEQVDAYYMKGKSHDCGSKLGYMKANVEYALRHPSLGDEFKEYLASVVK
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaggttaaaaaagcggtaatccctgtagcgggccttgggacgagaatgctccca
gcaacgaaagctattccaaaagagatgttgccagtggttgataagccattgatccaatac
gtggtaagcgaatgtgttgctgcaggactaaaagaaattatcctagtaacgcacgcgagt
aaaaacagtattgaaaaccactttgatacctcttttgaactagaagccacactagaaaag
cgtgtaaaacgccaactgttagaagaagttcagtcaatctgtccaaaagatgtaactatc
atgcatattcgccaaggcgttgctaatggacttgggcacgcagtactttgcgctcgacct
ttgattggcgatgcgccatttgcggtagtattacctgacgttatcattgatgatgcagca
agtaatcctaaaaaggataaccttgcagacatggttgccaaatttaacaccagccgagta
agtcaggtcatggttgagcaggtaccagacgaagatatctctaaatttggtatcgcagac
ctagacggtgcggcaattgcgccaggtgagtcagcgaagattcacaaaatggtagagaag
ccgcctcgcgacgaagcaccttctgaccttgctgttgtaggccgatacgttctgtcagaa
aaaatctgggatctgttagagttcacgcctccaggagcaggtggtgaagttcagcttact
gatgctattgacgcattgatgaaacttgaacaagttgatgcctactacatgaaaggtaag
agtcacgattgcggtagtaagttgggttacatgaaagctaacgttgaatatgcgttacgt
cacccatcgttaggcgacgaatttaaagaatacttagcgtctgttgttaaatag

DBGET integrated database retrieval system