KEGG   Alteromonas macleodii Balearic Sea AD45: AMBAS45_08230Help
Entry
AMBAS45_08230     CDS       T02253                                 

Definition
(GenBank) acetyl-CoA acetyltransferase with thiolase domain
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
amb  Alteromonas macleodii Balearic Sea AD45
Pathway
amb00071  Fatty acid degradation
amb00072  Synthesis and degradation of ketone bodies
amb00280  Valine, leucine and isoleucine degradation
amb00310  Lysine degradation
amb00362  Benzoate degradation
amb00380  Tryptophan metabolism
amb00620  Pyruvate metabolism
amb00630  Glyoxylate and dicarboxylate metabolism
amb00640  Propanoate metabolism
amb00650  Butanoate metabolism
amb00900  Terpenoid backbone biosynthesis
amb01100  Metabolic pathways
amb01110  Biosynthesis of secondary metabolites
amb01120  Microbial metabolism in diverse environments
amb01130  Biosynthesis of antibiotics
amb01200  Carbon metabolism
amb01212  Fatty acid metabolism
amb02020  Two-component system
Brite
KEGG Orthology (KO) [BR:amb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AMBAS45_08230
   00630 Glyoxylate and dicarboxylate metabolism
    AMBAS45_08230
   00640 Propanoate metabolism
    AMBAS45_08230
   00650 Butanoate metabolism
    AMBAS45_08230
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AMBAS45_08230
   00072 Synthesis and degradation of ketone bodies
    AMBAS45_08230
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AMBAS45_08230
   00310 Lysine degradation
    AMBAS45_08230
   00380 Tryptophan metabolism
    AMBAS45_08230
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AMBAS45_08230
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AMBAS45_08230
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AMBAS45_08230
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:amb04147]
    AMBAS45_08230
Enzymes [BR:amb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     AMBAS45_08230
Exosome [BR:amb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AMBAS45_08230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AFT95121
UniProt: K0ED24
Position
1932462..1933637
Genome map
AA seq 391 aa AA seqDB search
MSNESVVIVAAKRTPMGGFNGNLSSLAATKLGEVAIKAACEAMDVSVIDEVIMGCVLPAG
LGQSPARQASLGAGLPLSAGVTTINKVCGSGLKAVMMAHDLIKAGSATAVVAGGMESMSN
APYMLPKARTGYRMGHGQVLDHMMLDGLENSYDGKAMGCFAQDTADEENISRGEMDEFAL
SSLSKAHEAINSGTFVDEIVPVTVSSRKGDTVVDTDEGPGSARPEKIPTLRPAFKKDGTV
TAANSSSISDGAAALVVMSESKANELGLAPLARVVAHATNSIEPENFTVAPVGAMEKVLD
KAGWTKEEVDLFEINEAFAMVTMLAVKKLGLDESKVNVKGGACALGHPIGASGARILVTL
LHALKQRGGRKGIASLCIGGGEGVALAVEML
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgagtaacgaatcagtagttattgtcgcggctaagcgcacaccaatgggtggtttcaac
ggtaatttgtcttcgcttgctgcgaccaaacttggagaagttgcgattaaagcagcctgt
gaagcgatggatgtctctgtaattgatgaagtcatcatggggtgtgtattacctgctggt
cttggtcaatctccagcgcgacaagcgtcactgggtgcggggcttccgctaagtgcaggt
gtgactacaatcaacaaagtatgtggctcgggcttaaaagcggtaatgatggcccacgat
ttaattaaagcaggtagtgcgacagcagtcgtggcgggtggaatggaaagcatgagtaat
gcgccatacatgttgcctaaagctagaactggatatcgtatgggtcatggtcaagtactt
gatcatatgatgttagacggtctagaaaattcctatgacggcaaagcaatgggctgcttc
gcacaggatactgctgatgaagaaaatatttctcgcggtgaaatggatgagtttgctcta
agctcgctttccaaggcacatgaagcaataaacagcggaactttcgtcgatgaaatagta
cctgttacagtttcttctcgtaagggcgatactgttgttgataccgatgaaggcccaggt
tccgctcgccctgaaaaaattccaacactaagaccagctttcaaaaaagacggtacggtc
acggctgctaactcaagctcaatctcggatggagcagcggcactggttgtaatgagcgaa
agcaaagcaaatgaacttggtctagcaccgcttgcgcgcgtggttgctcacgctacaaat
tctattgaacctgaaaacttcaccgttgcgcctgttggcgctatggaaaaagtgctggat
aaagcaggttggacgaaagaagaagtcgatcttttcgaaattaacgaagcattcgccatg
gtaactatgttggcagtcaagaagcttggactagatgaaagtaaagtaaacgtaaaaggt
ggcgcttgtgcattgggtcacccaattggagcctctggtgcacgcattttggtaacacta
cttcacgcgcttaagcaacgcggtggtcgcaaaggtatcgcatctttatgtattggtggt
ggtgagggtgtagcgcttgccgttgaaatgctctaa

DBGET integrated database retrieval system