KEGG   Alteromonas macleodii Balearic Sea AD45: AMBAS45_09645Help
Entry
AMBAS45_09645     CDS       T02253                                 

Definition
(GenBank) putative succinate dehydrogenase, hydrophobic subunit, cytochrome b556 with sdhC
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
amb  Alteromonas macleodii Balearic Sea AD45
Pathway
amb00020  Citrate cycle (TCA cycle)
amb00190  Oxidative phosphorylation
amb00650  Butanoate metabolism
amb01100  Metabolic pathways
amb01110  Biosynthesis of secondary metabolites
amb01120  Microbial metabolism in diverse environments
amb01130  Biosynthesis of antibiotics
amb01200  Carbon metabolism
Module
amb_M00009  Citrate cycle (TCA cycle, Krebs cycle)
amb_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
amb_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:amb00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AMBAS45_09645
   00650 Butanoate metabolism
    AMBAS45_09645
  Energy metabolism
   00190 Oxidative phosphorylation
    AMBAS45_09645
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt DUF2975
Motif
Other DBs
NCBI-ProteinID: AFT95400
UniProt: K0EJ66
Position
2265284..2265631
Genome map
AA seq 115 aa AA seqDB search
MVTNQASIKRDGVQDYVSLRATAAIIFAYSVFMAWFFITTDNLTFIEWRGLFSGLAMKVF
TLAALVAVMIHVRIGLWQVLTDYVKSAGLRAGLQYILNIIAFGYVAVGLFVLWGV
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggtaaccaaccaagcaagcattaagcgtgacggcgtacaagactacgtttcacttcgc
gctacagcagcaattattttcgcgtactcggttttcatggcgtggttctttattaccacc
gataacctaacgtttatcgaatggcgagggttgttctctggcctggctatgaaagttttc
acattggcagcactagtagcagtgatgatccacgtgcgcatcggcctttggcaggtgctt
acagactatgttaaatcagcaggtctgcgcgcgggactacaatatatcttaaatatcatc
gcattcggctatgtagctgttggcctattcgtattgtggggagtgtaa

DBGET integrated database retrieval system