KEGG   Alteromonas macleodii Balearic Sea AD45: AMBAS45_11815Help
Entry
AMBAS45_11815     CDS       T02253                                 

Definition
(GenBank) glucose-6-phosphate 1-dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
amb  Alteromonas macleodii Balearic Sea AD45
Pathway
amb00030  Pentose phosphate pathway
amb00480  Glutathione metabolism
amb01100  Metabolic pathways
amb01110  Biosynthesis of secondary metabolites
amb01120  Microbial metabolism in diverse environments
amb01130  Biosynthesis of antibiotics
amb01200  Carbon metabolism
Module
amb_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
amb_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
amb_M00008  Entner-Doudoroff pathway, glucose-6P => glyceraldehyde-3P + pyruvate
Brite
KEGG Orthology (KO) [BR:amb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    AMBAS45_11815
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    AMBAS45_11815
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:amb04147]
    AMBAS45_11815
Enzymes [BR:amb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     AMBAS45_11815
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     AMBAS45_11815
Exosome [BR:amb04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   AMBAS45_11815
  Exosomal proteins of colorectal cancer cells
   AMBAS45_11815
  Exosomal proteins of bladder cancer cells
   AMBAS45_11815
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-ProteinID: AFT95828
UniProt: K0EGX0
Position
complement(2753906..2755399)
Genome map
AA seq 497 aa AA seqDB search
MVLDNSYEPCDFVLFGTLGDLSRRKLLPSLYQLEKANLMHPDTTIVGVARQEMELDAYIE
EVHANLIKFGEKNLCEATWEKMKARLHYACVDMKDVESYCVLDDHVDPSRTMVCYLATPP
AIYGDICRGLHSCKIIDSSVRVVLEKPIGHDLASSKVINEQVAEYFDEKQIYRIDHYLGK
ETVLNLVSLRFANSIFATNWDHNCIDHVQISVAESVGIEGRWGYFDDAGQMRDMVQNHLL
QILSLVAMEPPTTLDADSIRDEKLKVLKALRPINSFNINDSTVRGQYTSGFVKGEEVPGY
LEEEGANTQSKTETFVAIKAEIDNWRWAGVPFYLRTGKRMPTKVSEVVIYFKRQPHNLFG
DSFKNLPPNKLVIRLQPDEGVEITVMNKVPGLTSSGSMDLQKSKLNLSFSEAFADERIPD
AYEKLLLEVMLGNQALFVRRDEIEQAWTWVDSILEAWKQSSEPPEPYQAGTWGPVDSIGL
LARENRSWYESKTGKKK
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atggtattggataattcctacgaaccctgtgattttgtacttttcggtacactgggagat
ctttcacgacgcaagttgttgccttctttatatcagcttgaaaaagcaaacttgatgcac
ccagacaccactattgtgggtgttgcgcgtcaagaaatggagctggatgcttatattgaa
gaagttcatgccaacctaatcaagtttggcgagaagaacttgtgtgaagccacttgggaa
aaaatgaaagcgcgtttgcactatgcatgcgtagacatgaaagacgttgaaagctattgc
gtattagacgaccacgttgacccaagccgcaccatggtgtgttatttagcgacgccaccg
gcgatatacggtgatatctgtcgtggcctgcatagctgcaaaattatcgactcaagcgtt
cgcgttgtgctagaaaagccaattggtcacgatttggcatcgtcaaaagtgatcaatgag
caagttgcagaatacttcgacgaaaagcaaatttaccgtattgaccattacttaggtaaa
gaaactgttcttaaccttgtatcactgagatttgccaactcgattttcgctactaactgg
gaccacaactgcattgaccatgttcaaatctcagttgcagagtcagtgggtattgaaggg
cgttggggttactttgacgacgcgggtcaaatgcgagatatggtgcaaaaccacttgcta
caaattctaagcttggtagcgatggagcctccgacaacgctcgacgctgacagcattcgt
gacgaaaaattgaaagtactaaaagcgcttcgtccgattaactcgtttaatattaatgac
agcacagtgcgcggtcagtatacctctggtttcgtgaagggcgaagaagtgcctgggtac
cttgaagaagaaggtgccaatacgcaaagtaaaactgaaacctttgttgcgattaaagcg
gaaattgataactggcgttgggctggtgtgccgttctacctacgcacaggtaagcgcatg
ccaactaaggtgagtgaagttgttatttacttcaagcgtcagccgcacaacttattcggt
gacagcttcaagaatctcccacctaataagctcgttattcgtctacagccggacgaaggt
gtagaaatcactgtaatgaacaaagtgcctggtttaactagctcaggctctatggatcta
caaaaatccaagttaaacctaagtttctctgaagcgtttgccgatgagcgtattcctgac
gcatacgaaaaactccttcttgaagttatgttgggtaatcaggcgctattcgttcgtcgt
gacgaaattgagcaagcttggacgtgggtagactcaattcttgaagcgtggaagcaatcg
agcgagccgccagaaccgtatcaagcaggtacgtgggggccggtagactctataggtctt
cttgctcgcgaaaatcgcagctggtacgaaagcaaaacagggaagaaaaagtaa

DBGET integrated database retrieval system