KEGG   Alteromonas macleodii Balearic Sea AD45: AMBAS45_13575Help
Entry
AMBAS45_13575     CDS       T02253                                 

Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
amb  Alteromonas macleodii Balearic Sea AD45
Pathway
amb00630  Glyoxylate and dicarboxylate metabolism
amb01100  Metabolic pathways
amb01110  Biosynthesis of secondary metabolites
amb01120  Microbial metabolism in diverse environments
amb01200  Carbon metabolism
Module
amb_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:amb00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    AMBAS45_13575
Enzymes [BR:amb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     AMBAS45_13575
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase DUF3829
Motif
Other DBs
NCBI-ProteinID: AFT96178
UniProt: K0EHU1
Position
3163603..3165198
Genome map
AA seq 531 aa AA seqDB search
MSQYQQDIDNFATLKAAQNGTWEGINPEFAARMKVQNRFKTGLDIARYTASIMRKDMAEY
DADSSQYTQSLGCWHGFVGQQKMLSVKKHQGTTNKSYLYLSGWMVAALRSEFGPLPDQSM
HEKTSVSALIEELYTFLRQADARELGDLFHKLDDAKKNGGDVAAIQAEIDNYETHVVPII
ADIDAGFGNEEATYLLAKQMIEAGACCIQIENQVSDAKQCGHQDGKVTVPHEDFLAKINA
VRYAFLELGVDEGVIVARTDSLGAGLTQKIPVSTSEGDLAAQYNAFLKTTEVAGAEDLSE
GDLVLKQGGKLVKPERLPNGLFRFKDNTGFDRVVLDCVTSLKHGADLLWIETEKPHVGQI
AEMVNAIREQVPNAKLVYNNSPSFNWTLNFRQQVFDAWSEEGKDVSGYDRAKLMSADYDD
SELAAAADEKIKSFQADAAREAGIFHHLITLPTYHTAALSTDNLAKGYFGEEGMLAYVRG
VQRQEIRQGLACVKHQAMAGSDLGDTHKEYFSGEGALKASGEDNTMNQFDV
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcaatatcaacaagacattgataacttcgccacattaaaggcagcacaaaacgga
acgtgggaaggtatcaacccagaattcgctgcacgcatgaaggttcaaaaccgttttaaa
acaggtttagacattgctcgctacactgcaagcattatgcgcaaagacatggctgaatac
gacgcagattcgtctcagtacacacagtcactaggctgctggcatggctttgtaggccaa
caaaaaatgctttcagttaaaaagcatcaaggcacaactaacaaaagctacctttacctt
tcaggctggatggtagcagcacttcgctctgagtttggtcctcttcctgaccaatcaatg
cacgaaaaaacatcagtgtctgcgcttatcgaagaactttacactttccttcgccaagca
gatgcgcgtgaattaggcgaccttttccacaagctagacgatgctaagaaaaacggtggt
gatgtagctgcgattcaagctgaaatcgacaattacgaaactcacgtagttccaattatc
gctgatatcgatgcgggctttggtaacgaagaagcaacctacctacttgcaaagcaaatg
attgaagcaggtgcatgctgtatccaaattgaaaaccaagtatcggacgcgaagcaatgt
ggtcaccaagacggtaaagtaaccgtgccacacgaagacttcctagcgaaaatcaatgca
gtacgctatgcattccttgaactgggtgttgatgaaggtgtaattgttgcacgtactgac
tcactaggtgctggtcttactcaaaagatcccagtatctacatcagaaggcgacttagct
gctcagtacaatgctttccttaaaaccaccgaagttgcaggggcagaagatctaagtgaa
ggtgacctagttcttaagcaaggtggcaaactggttaagcctgagcgtctaccaaacggc
ttgttccgctttaaagacaacacaggttttgaccgtgtagtacttgactgcgtaacgtca
cttaagcacggcgctgacttgctttggattgagactgaaaagcctcacgttggccaaatt
gctgaaatggttaacgctattcgcgaacaagtaccaaacgcaaagctggtttataacaac
tctccatcattcaactggacgcttaacttccgtcagcaagtatttgatgcttggagtgaa
gaaggtaaagacgtttctggctacgaccgcgcgaaacttatgtctgccgactatgatgac
agcgagcttgcagctgcggccgacgagaagattaagagcttccaggctgacgcagcacgc
gaagcgggtatcttccaccaccttattacgctaccgacttatcatactgcagcactgtct
actgacaaccttgcaaaaggttacttcggtgaagaaggtatgcttgcttatgtacgcggt
gttcagcgtcaagaaattcgccaaggtctagcgtgtgttaagcaccaagcgatggcaggt
tctgacctaggtgatacacacaaagagtacttctctggtgaaggtgcacttaaagcgtct
ggtgaagataacaccatgaaccagtttgacgtataa

DBGET integrated database retrieval system