KEGG   Alteromonas mediterranea DE: MADE_1003975Help
Entry
MADE_1003975      CDS       T00747                                 

Gene name
apaG
Definition
(GenBank) cobalt transporter
  KO
K06195  ApaG protein
Organism
amc  Alteromonas mediterranea DE
Brite
KEGG Orthology (KO) [BR:amc00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    MADE_1003975 (apaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 DUF4354 Phage_TTP_13
Motif
Other DBs
NCBI-ProteinID: AEA96943
UniProt: F2GA16
Position
complement(856120..856494)
Genome map
AA seq 124 aa AA seqDB search
MDVLDIKVRVKTRHLPDHLPSDSKQFAFAYHITIENKSNHTVQLINRYWKITDANGKTSE
IEGAGVVGKQPFLKAGEQFEYTSGAVINTPVGNMEGYYEMELESKERFRVPINVFRLAIP
SILH
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atggatgtacttgatataaaggtgcgggtgaaaacccgccaccttccagaccaccttcct
tcagattcaaagcagtttgcttttgcctatcacatcactattgaaaacaagagcaatcat
accgttcagctgatcaaccgctattggaagatcaccgatgccaacggtaaaacctctgaa
atagaaggtgctggggtagtaggtaaacaacctttcttaaaagccggtgaacagtttgaa
tataccagtggtgcggttattaacacacctgtggggaatatggaaggctattatgagatg
gagctagagagcaaagaacgctttcgagttcctatcaatgtatttcgattagccattcca
agcattcttcattaa

DBGET integrated database retrieval system