KEGG   Alteromonas mediterranea DE: MADE_1006120Help
Entry
MADE_1006120      CDS       T00747                                 

Definition
(GenBank) oxaloacetate decarboxylase
  KO
K01571  oxaloacetate decarboxylase (Na+ extruding) subunit alpha [EC:7.2.4.2]
Organism
amc  Alteromonas mediterranea DE
Pathway
amc00620  Pyruvate metabolism
amc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:amc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    MADE_1006120
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:amc02000]
    MADE_1006120
Enzymes [BR:amc01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.4  Linked to decarboxylation
    7.2.4.2  oxaloacetate decarboxylase (Na+ extruding)
     MADE_1006120
Transporters [BR:amc02000]
 Other transporters
  Primary active transporters [TC:3]
   MADE_1006120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PYC_OADA HMGL-like Biotin_lipoyl Biotin_lipoyl_2 HlyD_3 HlyD_D23 GCV_H PTS_EIIA_1 RnfC_N
Motif
Other DBs
NCBI-ProteinID: AEA97366
UniProt: F2G424
Position
1236579..1238393
Genome map
AA seq 604 aa AA seqDB search
MSKPLALTELVLRDAHQSLLATRMRIEDMLPIAEKLDKAGFWSVESWGGATFDACIRYLG
EDPWERIRKLKAAMPNTKQQMLLRGQNLLGYRHYADDVVTRFVERAHESGVDVFRIFDAM
NDIRNLKTAIKATIDSGAHAQGTISYTVSPVHNLKLWLDMAKQLEDLGVHSICIKDMAGL
LKPYECEALITGLKETVSVPIAMQCHATTGLSTATYQKAVDAGIDMLDTAISSMSMTYGH
TATETMVSIVEGTERDTGIALPELEEIASYFRDVRKKYSKFEGSLKGVDARILLAQVPGG
MLTNMESQLKEQGAEDKFEEVLKEIPRVREDLGFIPLVTPTSQIVGTQSVLNVLTGERYK
SITKETAGVLKGEYGATAAPVNKALQERVLDGAEPVTCRPADNIAPELDALSKELDELAE
KKQLSLSDDKIDDVLTYALFPQIGLKFIENRGNPDAFEPAPSAQSSQSADVAQVEKTAAN
TSTSGSETYDVNVDGKVYHVEVAPSGTLTSVTPAGAAQSSAPASASNTQASASTSQSIDA
PLAGNVFKILVKNGDSIAEGDVVMILEAMKMETEIRAAFTGTVTEVTVGEGDAVSSGQPL
ILLG
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atgtctaagcctctggcccttaccgagctggtcctgcgtgatgcccatcagtcactacta
gctacgcgaatgcgtattgaagatatgcttcccattgcggaaaaattagataaagctggc
ttttggtcagtagagtcgtggggcggcgctacctttgacgcttgcattcgatacttggga
gaagacccatgggaacgtattagaaagctaaaagccgccatgcctaataccaagcagcaa
atgttgctacgaggccaaaacttgctggggtatcgacattacgctgacgatgttgtgact
cgctttgtagagcgcgcccatgaaagcggcgttgatgtatttagaatttttgatgcaatg
aacgacatcagaaatttaaaaacggcaattaaagcaaccatagacagcggtgcgcacgcg
caaggcaccatttcatataccgtaagcccagtgcacaatctaaagctttggcttgatatg
gccaaacagcttgaggacttaggcgttcattccatttgtattaaagatatggcagggctt
ttaaagccttacgaatgcgaagcgctcataacagggctgaaggaaacggtaagtgtacct
attgccatgcagtgtcatgctacgacagggttaagtactgccacctatcaaaaagccgta
gacgcgggcattgatatgctcgacaccgctatctcgtcaatgagtatgacatatggccat
accgccactgaaacgatggtatcgattgtagagggtacagagcgtgacaccggcatcgca
ttgccagaactggaagaaattgccagctacttcagagatgtaagaaagaaatacagcaag
tttgaaggaagcttaaagggcgttgacgcacggattttgctagcgcaagtgccaggcggc
atgctaaccaacatggaaagccagctaaaagaacagggcgctgaagataaattcgaagaa
gtactaaaagaaattccacgggtacgggaagatctcgggtttattcctcttgttacgcca
acctctcaaattgtaggcacgcaatcggtacttaacgtactaacaggcgagcgctacaag
agcatcacgaaagaaaccgctggcgtacttaaaggcgaatacggcgccaccgcggcacca
gtaaataaagcgctgcaagagcgtgtgcttgatggtgctgagcctgtgacgtgccgaccg
gctgataacattgcccccgaacttgatgcactaagtaaagagcttgatgaactcgcagag
aaaaagcagctttcgctatcagatgacaaaattgatgatgtgcttacttacgccttgttc
ccgcagataggccttaagtttatcgaaaatcgcggtaatcctgatgcgtttgaacctgca
cctagtgcacagtcatcgcagtcagcagatgtagctcaagtagaaaaaactgcagcaaac
acgtctacatctggcagcgaaacttacgatgtaaacgttgatggtaaggtgtatcacgta
gaagtcgcaccatccggtaccttaacaagcgtaacaccagcaggtgctgctcaatcatcg
gcgccagcgtcagcgagcaatactcaggcatctgcaagcacttcccagtctattgatgca
ccgttagcgggtaacgtatttaagatactcgttaaaaacggtgacagtattgccgaaggt
gatgtagttatgatccttgaagccatgaaaatggaaacggagatccgcgctgcgttcacc
ggcacggtaacggaagttactgttggggaaggcgatgccgtgtccagtggccaaccattg
atcttattggggtag

DBGET integrated database retrieval system