KEGG   Alteromonas mediterranea DE: MADE_1006875Help
Entry
MADE_1006875      CDS       T00747                                 

Definition
(GenBank) tryptophan synthase subunit alpha
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
amc  Alteromonas mediterranea DE
Pathway
amc00260  Glycine, serine and threonine metabolism
amc00400  Phenylalanine, tyrosine and tryptophan biosynthesis
amc01100  Metabolic pathways
amc01110  Biosynthesis of secondary metabolites
amc01130  Biosynthesis of antibiotics
amc01230  Biosynthesis of amino acids
Module
amc_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:amc00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MADE_1006875
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    MADE_1006875
Enzymes [BR:amc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     MADE_1006875
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth RsmJ NanE GatB_Yqey
Motif
Other DBs
NCBI-ProteinID: AEA97517
UniProt: F2G5U6
Position
complement(1537609..1538418)
Genome map
AA seq 269 aa AA seqDB search
MDRYAQMFTGLDKKNQGAFVPFVMVGDPDLAQSEAIICQLIESGADALELGIPYSDPIAD
GPTIQASAIRALESEVTVADCLSVIARVRAKYPEVPIGLLLYSNLVMAQGIENFYSKARD
AGVDSILVADVPIREAVPFQKAAENTGISQILIAPPNATEETMEKIGEYSEGYTYLLGRA
GVTGAETAANVPASELIERLNKHKAAPALLGFGISTPEQVKSAIDAGAAGAISGSATVNI
IAANLSDSHKMLSELGTFVENMKAATTKG
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atggacagatatgcacagatgtttacgggccttgataagaaaaaccaaggcgcattcgtg
cccttcgtcatggtgggcgacccagatttagcacagtcagaagctattatctgccagctt
atagaaagcggagcagatgcgctagagctaggcattccttattcagacccgattgctgac
ggcccaaccatccaggcttctgccattcgcgcactagaaagcgaggtgactgtagcggat
tgtttgagtgtaatcgcccgcgttcgagcaaagtaccctgaggtgccaattggcttattg
ctgtatagcaacctggtaatggcgcagggtatcgaaaacttctacagtaaagcgcgtgac
gctggcgtagactcaatactggtggcagacgttccgattcgagaagctgtgcctttccaa
aaagcggctgaaaacaccggtatttcgcaaattttgattgcaccaccgaatgcgactgaa
gaaaccatggaaaagattggcgagtactcagaaggttacacttacctattgggtcgcgca
ggggttacgggggccgaaactgctgcgaatgttccagcttctgagcttatcgagcgtttg
aacaaacacaaggctgcgccggcgctactaggttttggtatctcaacgccggaacaagtc
aaatctgctattgatgccggcgctgcaggtgccatttcaggttcagcgacagtaaatatt
attgccgctaacttatcggacagtcacaaaatgcttagcgagctaggtacatttgttgaa
aacatgaaagcggcgacaactaaggggtaa

DBGET integrated database retrieval system