KEGG   Alteromonas mediterranea DE: MADE_1008785Help
Entry
MADE_1008785      CDS       T00747                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
amc  Alteromonas mediterranea DE
Pathway
amc00071  Fatty acid degradation
amc00072  Synthesis and degradation of ketone bodies
amc00280  Valine, leucine and isoleucine degradation
amc00310  Lysine degradation
amc00362  Benzoate degradation
amc00380  Tryptophan metabolism
amc00620  Pyruvate metabolism
amc00630  Glyoxylate and dicarboxylate metabolism
amc00640  Propanoate metabolism
amc00650  Butanoate metabolism
amc00900  Terpenoid backbone biosynthesis
amc01100  Metabolic pathways
amc01110  Biosynthesis of secondary metabolites
amc01120  Microbial metabolism in diverse environments
amc01130  Biosynthesis of antibiotics
amc01200  Carbon metabolism
amc01212  Fatty acid metabolism
amc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:amc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    MADE_1008785
   00630 Glyoxylate and dicarboxylate metabolism
    MADE_1008785
   00640 Propanoate metabolism
    MADE_1008785
   00650 Butanoate metabolism
    MADE_1008785
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MADE_1008785
   00072 Synthesis and degradation of ketone bodies
    MADE_1008785
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MADE_1008785
   00310 Lysine degradation
    MADE_1008785
   00380 Tryptophan metabolism
    MADE_1008785
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    MADE_1008785
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MADE_1008785
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    MADE_1008785
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:amc04147]
    MADE_1008785
Enzymes [BR:amc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     MADE_1008785
Exosome [BR:amc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MADE_1008785
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III ChlamPMP_M CHGN
Motif
Other DBs
NCBI-ProteinID: AEA97895
UniProt: F2GAA1
Position
1921900..1923081
Genome map
AA seq 393 aa AA seqDB search
MRDAVIVSTARTPIGRAYKGALNNLPAPSLGGHAIENAVSRAGIDPASVDDVIMGAALTQ
GSGGMNIGRLAGLAGGLPVTVAGMTLDRQCSSGMYAIATAANAIRTGDTNIMVAGGLDSI
SLVQNKNMNMFRAVDPALVAKHKDIYMPMLQTAEVVGKRYNISRDVQDEYGYQSQMRTAA
AQEAGKFDDEIVPITAVQAVFNKETGETSEREVTLSKDEGNRPETTLEGLKALNPVIEGG
CITAGNASQLSDGASATVIMDEQSAAKGSAQPLGIYRGIAVAGCEPDEMGIGPVFAIPKL
LKQHGLTMDDIGLWELNEAFAVQVLYCRDKLGIPDELLNVNGGAISIGHPYGMSGARMVG
HALIEGKRRGAKYVVCTMCIGGGMGAAGLFEVI
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgatgcagtaattgtaagtacagcacgtacaccaataggccgtgcctataaaggc
gcactaaacaacttacccgcgccgtcgttaggtggtcatgccattgaaaatgcggtatct
cgtgcgggtattgaccctgctagcgtagatgacgtcatcatgggcgcagcgctcacacaa
ggcagcggtggtatgaacatcggccggttagccgggcttgccggcggccttcctgttacg
gttgcgggtatgacccttgaccgtcaatgtagttcaggtatgtacgccatcgctacagca
gcaaatgctattcgtactggcgataccaacattatggtagccggtggtttagattctatt
tcactggtacaaaacaagaacatgaatatgttccgtgccgttgaccctgcacttgttgct
aagcacaaagatatctacatgccgatgcttcaaaccgctgaagtggtaggcaagcgttat
aacattagccgcgatgtacaagatgagtacggctaccaaagtcaaatgcgcacagcagca
gcgcaagaggccggtaagtttgacgacgaaattgtacctattacagcagttcaagcggtg
ttcaataaagaaacgggtgaaacctctgagcgcgaagtcaccttgtctaaagatgaaggt
aatcgcccagaaactactcttgaaggtttgaaagcgttaaaccctgttattgaaggcggc
tgcattacagctggcaacgcgagccagctttcagacggcgcaagtgcaacagttattatg
gatgagcagtcagcagcgaaaggcagtgctcagccacttggtatttatcgcggtattgca
gtggcaggctgtgaacctgatgaaatgggaattggcccggtattcgccattcctaagcta
ttaaagcagcatggattaaccatggacgatatcggtctatgggaacttaacgaagcattt
gcagtacaggtactctactgccgcgacaagttaggtattccagacgaattattaaatgta
aacggcggtgccatttctattggtcacccatacggcatgagcggtgctcgcatggtgggt
cacgcactcatcgaaggtaaacgacgtggtgcgaaatatgtagtttgcaccatgtgtatc
ggtggcggcatgggcgctgctggtctatttgaagttatatag

DBGET integrated database retrieval system